XChem group deposition -- Crystal Structure of human YEATS4 in complex with FM000199e. Determined by X-ray diffraction at 1.64 Å resolution. Released 30 Dec 2020.
Explore 5R68 in 3D Show helices and sheets RCSB PDB PDBe
5R68 contains 7 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 20-33 | 14 | 3 |
| β-strand | 45-53 | 9 | 3 |
| α-helix | 59-61 | 3 | |
| β-strand | 63-69 | 7 | 4 |
| β-strand | 78-81 | 4 | 4 |
| β-strand | 86-92 | 7 | 3 |
| β-strand | 97-104 | 8 | 4 |
| α-helix | 110-111 | 2 | |
| β-strand | 112-117 | 6 | 4 |
| β-strand | 133-145 | 13 | 3 |
| α-helix | 149-155 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 20-33 | 14 | 1 |
| β-strand | 45-53 | 9 | 1 |
| α-helix | 59-61 | 3 | |
| β-strand | 63-69 | 7 | 2 |
| β-strand | 78-81 | 4 | 2 |
| β-strand | 86-92 | 7 | 1 |
| β-strand | 97-104 | 8 | 2 |
| α-helix | 110-111 | 2 | |
| β-strand | 112-117 | 6 | 2 |
| β-strand | 132 | 1 | 3 |
| α-helix | 133 | 1 | |
| β-strand | 134-145 | 12 | 1 |
| α-helix | 149-155 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| YEATS domain-containing protein 4 | A, B | protein | 181 | Homo sapiens | O95619 (AlphaFold model) |
>5R68_1 YEATS domain-containing protein 4 (chains A, B) MGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGN PLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVS EFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTAHHHHH H
| ID | Name | Formula | Copies |
|---|---|---|---|
| RYD | (1-methylbenzotriazol-5-yl)methanol | C8 H9 N3 O | 2 |
Water and common crystallization additives (EDO) are not listed.
XChem group deposition. Raux, B., Krojer, T., von Delft, F. et al. To be published.
Other PDB entries of the same protein (UniProt O95619 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5R68 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.