5SXP: The interaction between itch prr and beta-pix
Structural basis for the interaction between itch prr and beta-pix. Determined by X-ray diffraction at 1.65 Å resolution. Released 1 Mar 2017.
- Method
- X-ray diffraction
- Resolution
- 1.65 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 2,704
- Mol. weight
- 34.01 kDa
- Released
- 1 Mar 2017
Explore 5SXP in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5SXP contains 8 α-helices and 33 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 188-191 | 4 | 1 |
| β-strand | 195 | 1 | 2 |
| β-strand | 202 | 1 | 1 |
| β-strand | 205 | 1 | 2 |
| β-strand | 210-215 | 6 | 1 |
| β-strand | 216 | 1 | 3 |
| β-strand | 221-226 | 6 | 1 |
| β-strand | 229-234 | 6 | 1 |
| α-helix | 235-237 | 3 | |
| β-strand | 238-240 | 3 | 1 |
Chain B: 1 helix, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 188-191 | 4 | 3 |
| β-strand | 195 | 1 | 4 |
| β-strand | 202 | 1 | 3 |
| β-strand | 205 | 1 | 4 |
| β-strand | 210-216 | 7 | 3 |
| β-strand | 221-226 | 6 | 3 |
| β-strand | 229-234 | 6 | 3 |
| α-helix | 235-237 | 3 | |
| β-strand | 238-240 | 3 | 3 |
Chain C: 1 helix, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 188-191 | 4 | 5 |
| β-strand | 195 | 1 | 6 |
| β-strand | 202 | 1 | 5 |
| β-strand | 205 | 1 | 6 |
| β-strand | 210-216 | 7 | 5 |
| β-strand | 221-226 | 6 | 5 |
| β-strand | 229-234 | 6 | 5 |
| α-helix | 235-237 | 3 | |
| β-strand | 238-241 | 4 | 5 |
Chain D: 1 helix, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 188-191 | 4 | 7 |
| β-strand | 195 | 1 | 8 |
| β-strand | 202 | 1 | 7 |
| β-strand | 205 | 1 | 8 |
| β-strand | 210-215 | 6 | 7 |
| β-strand | 221-226 | 6 | 7 |
| β-strand | 229-234 | 6 | 7 |
| α-helix | 235-237 | 3 | |
| β-strand | 238-240 | 3 | 7 |
Chain F: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 252-256 | 5 | |
| α-helix | 259-265 | 7 | |
Chain G: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 259-262 | 4 | |
| α-helix | 264-265 | 2 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Rho guanine nucleotide exchange factor 7 | A, B, C, D | protein | 62 | Homo sapiens | Q14155 (AlphaFold model) |
| E3 ubiquitin-protein ligase Itchy homolog | F, G | protein | 27 | Homo sapiens | Q96J02 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>5SXP_1 Rho guanine nucleotide exchange factor 7 (chains A, B, C, D)
GSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREV
KA
Sequence of entity 2 (F, G), FASTA
>5SXP_2 E3 ubiquitin-protein ligase Itchy homolog (chains F, G)
GSGGGKPSRPPRPSRPPPPTPRRPASY
Primary citation
Molecular basis of interactions between SH3 domain-containing proteins and the proline-rich region of the ubiquitin ligase Itch. Desrochers, G., Cappadocia, L., Lussier-Price, M. et al. J Biol Chem (2017) 292:6325-6338. DOI 10.1074/jbc.M116.754440 · PubMed
Other PDB entries of the same protein (UniProt Q14155 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1BY1 DBL homology domain from beta-PIX
- 1ZSG beta PIX-SH3 complexed with an atypical peptide from alpha-PAK
- 2L3G Solution NMR Structure of CH domain of Rho guanine nucleotide exchange factor 7 from…
Browse structure collections
About this viewer
MolViewer shows 5SXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.