5SZW: ELAV-like protein 1

NMR solution structure of the RRM1 domain of the post-transcriptional regulator HuR. Determined by solution NMR. Released 6 Sept 2017.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 786
Mol. weight: 11.22 kDa
Released: 6 Sept 2017

Explore 5SZW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5SZW contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	23-27	5	1
α-helix	35-45	11
β-strand	48-55	8	1
β-strand	62-70	9	1
α-helix	74-82	9
β-strand	87-88	2	2
β-strand	91-92	2	2
β-strand	94-97	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ELAV-like protein 1	A	protein	101	Homo sapiens	Q15717 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5SZW_1 ELAV-like protein 1 (chains A)
GHMSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAG
HSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPS

Primary citation

Oligomeric transition and dynamics of RNA binding by the HuR RRM1 domain in solution. Lixa, C., Mujo, A., de Magalhaes, M.T.Q. et al. J Biomol NMR (2018) 72:179-192. DOI 10.1007/s10858-018-0217-y · PubMed

Other PDB entries of the same protein (UniProt Q15717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GD3 1.35 Å, Structure of HuR RRM3 in complex with RNA (UAUUUA)
4FXV 1.9 Å, Crystal structure of an ELAV-like protein 1 (ELAVL1) from Homo sapiens at 1.90 A…
6GC5 1.9 Å, Molecular basis for AU-rich element recognition and dimerization by the HuR C-terminal RRM
6GD2 1.9 Å, Structure of HuR RRM3 in complex with RNA
3HI9 2.0 Å, The x-ray crystal structure of the first RNA recognition motif (RRM1) of the AU-rich…
4ED5 2.0 Å, Crystal structure of the two N-terminal RRM domains of HuR complexed with RNA
6G2K 2.01 Å, Structure of HuR RRM3 in complex with RNA (UUUUUU)
6GD1 2.01 Å, Structure of HuR RRM3
4EGL 2.9 Å, Crystal structure of two tandem RNA recognition motifs of Human antigen R
9W2F 3.4 Å, Cryo-EM structure of DDB1-CRBN in complex with dHuR-2 and HuR

Browse structure collections

About this viewer

MolViewer shows 5SZW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.