5T3T: Ebola virus VP30 CTD
Ebola virus VP30 CTD bound to nucleoprotein. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Sept 2016.
- Method
- X-ray diffraction
- Resolution
- 2.2 Å
- Organism
- Zaire ebolavirus (strain Mayinga-76)
- Chains
- 10
- Atoms
- 11,795
- Mol. weight
- 220.89 kDa
- Released
- 28 Sept 2016
Explore 5T3T in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5T3T contains 102 α-helices and 0 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A and F: 10 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 116-120 | 5 | |
| α-helix | 144-155 | 12 | |
| α-helix | 164-178 | 15 | |
| α-helix | 183-185 | 3 | |
| α-helix | 186-197 | 12 | |
| α-helix | 201-203 | 3 | |
| α-helix | 204-215 | 12 | |
| α-helix | 221-229 | 9 | |
| α-helix | 232-246 | 15 | |
| α-helix | 255-262 | 8 | |
Chains B and I: 11 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 116-120 | 5 | |
| α-helix | 144-155 | 12 | |
| α-helix | 164-178 | 15 | |
| α-helix | 183-185 | 3 | |
| α-helix | 186-197 | 12 | |
| α-helix | 201-203 | 3 | |
| α-helix | 204-215 | 12 | |
| α-helix | 221-229 | 9 | |
| α-helix | 232-246 | 15 | |
| α-helix | 255-261 | 7 | |
| α-helix | 262-264 | 3 | |
Chains C, D and G: 10 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 116-122 | 7 | |
| α-helix | 144-155 | 12 | |
| α-helix | 164-178 | 15 | |
| α-helix | 183-185 | 3 | |
| α-helix | 186-197 | 12 | |
| α-helix | 201-203 | 3 | |
| α-helix | 204-215 | 12 | |
| α-helix | 221-229 | 9 | |
| α-helix | 232-246 | 15 | |
| α-helix | 255-262 | 8 | |
Chain E: 10 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 116-121 | 6 | |
| α-helix | 144-155 | 12 | |
| α-helix | 164-178 | 15 | |
| α-helix | 183-185 | 3 | |
| α-helix | 186-197 | 12 | |
| α-helix | 201-203 | 3 | |
| α-helix | 204-215 | 12 | |
| α-helix | 221-229 | 9 | |
| α-helix | 232-246 | 15 | |
| α-helix | 255-262 | 8 | |
Chain H: 10 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 115-122 | 8 | |
| α-helix | 144-155 | 12 | |
| α-helix | 164-178 | 15 | |
| α-helix | 183-185 | 3 | |
| α-helix | 186-197 | 12 | |
| α-helix | 201-203 | 3 | |
| α-helix | 204-215 | 12 | |
| α-helix | 221-229 | 9 | |
| α-helix | 232-246 | 15 | |
| α-helix | 255-262 | 8 | |
Chain J: 10 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 116-122 | 7 | |
| α-helix | 144-155 | 12 | |
| α-helix | 164-178 | 15 | |
| α-helix | 183-185 | 3 | |
| α-helix | 186-197 | 12 | |
| α-helix | 201-203 | 3 | |
| α-helix | 204-215 | 12 | |
| α-helix | 221-229 | 9 | |
| α-helix | 232-243 | 12 | |
| α-helix | 255-262 | 8 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Fusion protein of Nucleoprotein and Minor nucleoprotein VP30 | A, B, C, D, E, F, G, H, I, J | protein | 193 | Zaire ebolavirus (strain Mayinga-76) | P18272 (AlphaFold model), Q05323 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA
>5T3T_1 Fusion protein of Nucleoprotein and Minor nucleoprotein VP30 (chains A, B, C, D, E, F, G, H, I, J)
MAHHHHHHVDDDDKMRTPTVAPPAPVYRDHSEKKELPQDEQQDGPKITLLTLIKTAEHWA
RQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEVYQRLH
SDKGGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEAST
NPGTCSWSDEGTP
Primary citation
The Ebola Virus VP30-NP Interaction Is a Regulator of Viral RNA Synthesis. Kirchdoerfer, R.N., Moyer, C.L., Abelson, D.M. et al. PLoS Pathog (2016) 12:e1005937-e1005937. DOI 10.1371/journal.ppat.1005937 · PubMed
Other PDB entries of the same protein (UniProt P18272 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4QB0 1.75 Å, The crystal structure of the C-terminal domain of Ebola (Zaire) nucleoprotein
- 4Z9P 1.79 Å, Crystal structure of Ebola virus nucleoprotein core domain at 1.8A resolution
- 4QAZ 1.98 Å, The crystal structure of the C-terminal domain of Ebola (Zaire) nucleoprotein
- 4ZTA 2.4 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide I212121
- 4ZTI 2.4 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide P212121
- 4ZTG 2.8 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide P22121
- 6NUT 3.1 Å, Ebola virus nucleoprotein - RNA complex
- 5Z9W 3.6 Å, Ebola virus nucleoprotein-RNA complex
- 4YPI 3.71 Å, Structure of Ebola virus nucleoprotein N-terminal fragment bound to a peptide derived…
- 8Y9J 4.6 Å, Structure of the Ebola virus nucleocapsid subunit
- 6C54 5.8 Å, Ebola nucleoprotein nucleocapsid-like assembly and the asymmetric unit
- 6EHL 6.6 Å, Model of the Ebola virus nucleoprotein in recombinant nucleocapsid-like assemblies
Browse structure collections
About this viewer
MolViewer shows 5T3T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.