5T6J: Kinetochore protein SPC24

Structure of the MIND Complex Shows a Regulatory Focus of Yeast Kinetochore Assembly. Determined by X-ray diffraction at 1.75 Å resolution. Released 9 Nov 2016.

Method: X-ray diffraction
Resolution: 1.75 Å
Organisms: Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Saccharomyces cerevisiae
Chains: 3
Atoms: 1,359
Mol. weight: 18.42 kDa
Released: 9 Nov 2016

Explore 5T6J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5T6J contains 8 α-helices and 7 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	157-167	11
β-strand	170-173	4	1
α-helix	174-176	3
β-strand	178-181	4	1
β-strand	190-193	4	1
α-helix	200-211	12

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	131-145	15
β-strand	147-151	5	2
β-strand	159-163	5	2
β-strand	169-173	5	2
β-strand	181-184	4	2
α-helix	190-197	8
α-helix	198-202	5
α-helix	206-220	15

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	561-570	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinetochore protein SPC24	A	protein	59	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	Q04477 (AlphaFold model)
Kinetochore protein SPC25	B	protein	92	Saccharomyces cerevisiae	P40014 (AlphaFold model)
Kinetochore-associated protein DSN1	C	protein	13	Saccharomyces cerevisiae	P40568 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5T6J_1 Kinetochore protein SPC24 (chains A)
ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK

Sequence of entity 2 (B), FASTA

>5T6J_2 Kinetochore protein SPC25 (chains B)
SNANDAAEVALYERLLQLRVLPGASDVHDVRFVFGDDSRCWIEVAMHGDHVIGNSHPALD
PKSRATLEHVLTVQGDLAAFLVVARDMLLASL

Sequence of entity 3 (C), FASTA

>5T6J_3 Kinetochore-associated protein DSN1 (chains C)
QQLLKGLSLSFSK

Primary citation

Structure of the MIND Complex Defines a Regulatory Focus for Yeast Kinetochore Assembly. Dimitrova, Y.N., Jenni, S., Valverde, R. et al. Cell (2016) 167:1014-1027.e12. DOI 10.1016/j.cell.2016.10.011 · PubMed

Other PDB entries of the same protein (UniProt Q04477 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FTX 1.9 Å, Crystal structure of the yeast kinetochore Spc24/Spc25 globular domain
4GEQ 2.01 Å, Crystal structure of the Spc24-Spc25/Cnn1 binding interface
7KDF 2.72 Å, Structure of Stu2 Bound to dwarf Ndc80c
5TCS 2.83 Å, Crystal structure of a Dwarf Ndc80 Tetramer
8V10 3.02 Å, Structure of a Saccharomyces cerevisiae Mps1 peptide bound to dwarf Ndc80 Complex
8V11 3.95 Å, Structure of a Saccharomyces cerevisiae Ipl1 peptide Bound to dwarf Ndc80 complex
9S4Q 4.9 Å, Cryo-EM structure of the Saccharomyces cerevisiae KMN junction complex lacking the…
9S5N 7.2 Å, Cryo-EM structure of the Saccharomyces cerevisiae KMN junction complex containing the…
5TD8 7.53 Å, Crystal structure of an Extended Dwarf Ndc80 Complex
2FV4 NMR solution structure of the yeast kinetochore Spc24/Spc25 globular domain

Browse structure collections

About this viewer

MolViewer shows 5T6J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.