5TCX: Human tetraspanin CD81

Crystal structure of human tetraspanin CD81. Determined by X-ray diffraction at 2.96 Å resolution. Released 9 Nov 2016.

Method: X-ray diffraction
Resolution: 2.96 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,628
Mol. weight: 27.59 kDa
Ligands: CLR
Released: 9 Nov 2016

Explore 5TCX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TCX contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	10-36	27
α-helix	57-80	24
α-helix	81-84	4
α-helix	89-114	26
α-helix	116-136	21
α-helix	141-154	14
α-helix	161-169	9
α-helix	182-186	5
α-helix	190-198	9
α-helix	202-230	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD81 antigen	A	protein	246	Homo sapiens	P60033 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5TCX_1 CD81 antigen (chains A)
RGVEGSTKSIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYV
GIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIA
KDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSN
IISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLSSGIRNSSVYVPHH
HHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CLR	Cholesterol	C27 H46 O	1

Primary citation

Crystal Structure of a Full-Length Human Tetraspanin Reveals a Cholesterol-Binding Pocket. Zimmerman, B., Kelly, B., McMillan, B.J. et al. Cell (2016) 167:1041-1051.e11. DOI 10.1016/j.cell.2016.09.056 · PubMed

Other PDB entries of the same protein (UniProt P60033 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M33 1.28 Å, Structural tuning of CD81LEL (space group P21)
1G8Q 1.6 Å, Crystal structure of human CD81 extracellular domain, A receptor for hepatitis C virus
3X0E 1.84 Å, Crystal structure of the ectodomain of human CD81 large extracellular loop (hCD81-LEL)
5M2C 1.96 Å, Structural tuning of CD81LEL (space group P32 1 2)
5M3T 2.02 Å, Structural tuning of CD81LEL (space group P64)
6EJM 2.15 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…
5DFW 2.33 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…
5M3D 2.38 Å, Structural tuning of CD81LEL (space group P31)
6U9S 2.4 Å, Crystal structure of human CD81 large extracellular loop in complex with 5A6 Fab
1IV5 2.6 Å, New Crystal Form of Human CD81 Large Extracellular Loop.
6EK2 2.65 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…
5DFV 2.8 Å, Crystal structure of human CD81 large extracellular loop in complex with murine FAB…

Browse structure collections

About this viewer

MolViewer shows 5TCX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.