5TQB: Assembly chaperone of ribosomal protein L4

Name: PDB 5TQB: Crystal structure of assembly chaperone of ribosomal protein L4 (Acl4) in complex with ribosomal protein L4 (RpL4)
Published: 2017-02-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

Crystal structure of assembly chaperone of ribosomal protein L4 (Acl4) in complex with ribosomal protein L4 (RpL4). Determined by X-ray diffraction at 2.4 Å resolution. Released 15 Feb 2017.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Chaetomium thermophilum, Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
Chains: 2
Atoms: 4,605
Mol. weight: 68.48 kDa
Released: 15 Feb 2017

Explore 5TQB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TQB contains 35 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
β-strand	16-22	7	1
α-helix	25-28	4
α-helix	35-39	5
β-strand	52-53	2	2
α-helix	54-55	2
α-helix	61-63	3
α-helix	75-77	3
α-helix	90-97	8
β-strand	105-106	2	2
α-helix	112-129	18
α-helix	133-138	6
β-strand	151-153	3	1
α-helix	155-157	3
α-helix	166-176	11
α-helix	179-185	7
β-strand	210-213	4	1
α-helix	215-218	4
α-helix	221-226	6
β-strand	233-236	4	1
α-helix	237-239	3
α-helix	242-245	4
α-helix	247-249	3
β-strand	255-258	4	1
α-helix	259-271	13

Chain B: 18 helices, 0 β-strands

Element	Residues	Length
α-helix	30-42	13
α-helix	46-58	13
α-helix	67-80	14
α-helix	84-97	14
α-helix	105-108	4
α-helix	112-120	9
α-helix	126-151	26
α-helix	157-182	26
α-helix	192-206	15
α-helix	211-223	13
α-helix	227-238	12
α-helix	252-253	2
α-helix	254-266	13
α-helix	270-283	14
α-helix	288-307	20
α-helix	308-310	3
α-helix	317-339	23
α-helix	344-359	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
60S ribosomal protein L4-like protein	A	protein	277	Chaetomium thermophilum	G0SFC3 (AlphaFold model)
Assembly chaperone of ribosomal protein L4 (Acl4)	B	protein	335	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0I4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5TQB_1 60S ribosomal protein L4-like protein (chains A)
MASRPTVTVFGADGKPTGATEVLPKVFSAPIRPDIVKHVHTGMAKNKRQPYAVSEKAGHQ
TSAESWGTGRAVARIPRVSGGGTHRAGQGAFGNMCRSGRMFAPTKIWRKWHVKINQGQKR
FATASALAASAVAPLLMARGHQVSTVPEVPLVVDSAAVAGDAVAKTAAAYKLLKAIGAGP
DVEKVKKSKKLRAGKGKMRGRRHRQRRGPLIVYSPEHDGKELVKGFRNIPGVETCPVDAL
NLLQLAPGGHLGRFIVWTSAAIKQLDAVYESKKGFFL

Sequence of entity 2 (B), FASTA

>5TQB_2 Assembly chaperone of ribosomal protein L4 (Acl4) (chains B)
SINPKELLDRATTLLEEGDIETAAKVARTAYEHIGENGRHAGAALTLLGQIHVELGDIDA
ARNYYAAAVKVDEDGSLPEELGGGPEKFLWLAQLSEEGGHDSVAWFERGATVLRAQIQSL
MDSLEQRPLSRGQVEAAIADKRRRLAETLCAVVEVYMTDLSWEDDAEQRCEALITEATMI
APEWPETWQTVANVRISQERTEEAREALRRSLGLWTHLPPEDPGVPPFPSRVSLVRLLIE
VDMEEEALEVTERLIAEDDLSVEVWYLGGYARYRLGEKEREASGQASEPEAWKDTWRSSR
KWLRQCLKVFEAEEYEDERLGEHAKELIASIIGEL

Primary citation

Molecular basis for protection of ribosomal protein L4 from cellular degradation. Huber, F.M., Hoelz, A. Nat Commun (2017) 8:14354-14354. DOI 10.1038/ncomms14354 · PubMed

Other PDB entries of the same protein (UniProt G0SFC3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PV7 2.12 Å, Chaetomium thermophilum pre-60S State 1 - pre-5S rotation (Arx1/Nog2 state) - Composite…
8PVL 2.19 Å, Chaetomium thermophilum pre-60S State 7 - pre-5S rotation lacking Utp30/ITS2 - composite…
9I78 2.2 Å, Cryo-EM structure of Chaetomium thermophilum ribosome-bound SND3 translocon
9I1W 2.38 Å, High resolution structure of the thermophilic 60S ribosomal subunit of Chaetomium…
8PVK 2.55 Å, Chaetomium thermophilum pre-60S State 5 - pre-5S rotation - L1 inward - composite…
8PV1 2.56 Å, Chaetomium thermophilum pre-60S State 6 - pre-5S rotation - L1 intermediate - composite…
8PV2 2.63 Å, Chaetomium thermophilum pre-60S State 10 - pre-5S rotation with Ytm1-Erb1
8I9Z 2.7 Å, Cryo-EM structure of a Chaetomium thermophilum pre-60S ribosomal subunit - State Spb4
8IA0 2.7 Å, Cryo-EM structure of a Chaetomium thermophilum pre-60S ribosomal subunit - State Puf6
8I9X 2.8 Å, Cryo-EM structure of a Chaetomium thermophilum pre-60S ribosomal subunit - Ytm1-1
8PV3 2.8 Å, Chaetomium thermophilum pre-60S State 9 - pre-5S rotation - immature H68/H69 - composite…
8PV5 2.86 Å, Chaetomium thermophilum pre-60S State 8 - pre-5S rotation without Foot - composite…

Browse structure collections

About this viewer

MolViewer shows 5TQB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.