5TUU: E2F4-DP1 coiled coil and marked-box domains

Crystal structure of the E2F4-DP1 coiled coil and marked-box domains. Determined by X-ray diffraction at 2.25 Å resolution. Released 3 May 2017.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,982
Mol. weight: 30.36 kDa
Released: 3 May 2017

Explore 5TUU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TUU contains 11 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	197-247	51
α-helix	250-252	3
β-strand	256-258	3	1
β-strand	262-267	6	2
β-strand	272-276	5	3
β-strand	282-287	6	3
β-strand	291-295	5	2
α-helix	296-303	8
α-helix	309-311	3
α-helix	316-324	9
α-helix	328-330	3
α-helix	331-337	7

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	96-129	34
α-helix	132-134	3
β-strand	139-141	3	1
α-helix	142-148	7
β-strand	152-158	7	2
β-strand	164-166	3	3
α-helix	168-171	4
β-strand	179-184	6	3
β-strand	191-194	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor DP1	A	protein	155	Homo sapiens	Q14186 (AlphaFold model)
Transcription factor E2F4	B	protein	111	Homo sapiens	Q16254 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5TUU_1 Transcription factor DP1 (chains A)
GEFAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQQASRPPPPNS
VIHLPFIIVNTSKKTVIDCSISNDKFEYLFNFDNTFEIHDDIEVLKRMGMACGLESGSCS
AEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTA

Sequence of entity 2 (B), FASTA

>5TUU_2 Transcription factor E2F4 (chains B)
GHMREIADKLIELKAEIEELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHEDICR
CFAGDTLLAIRAPSGTSLEVPIPEGLNGQKKYQIHLKSVSGPIEVLLVNKE

Primary citation

Conservation and divergence of C-terminal domain structure in the retinoblastoma protein family. Liban, T.J., Medina, E.M., Tripathi, S. et al. Proc Natl Acad Sci U S A (2017) 114:4942-4947. DOI 10.1073/pnas.1619170114 · PubMed

Other PDB entries of the same protein (UniProt Q14186 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2AZE 2.55 Å, Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer
5TUV 2.9 Å, Crystal structure of the E2F5-DP1-p107 ternary complex
5GOW Solution structure of the complex between DP1 acidic region and TFIIH p62 PH domain

Browse structure collections

About this viewer

MolViewer shows 5TUU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.