5UGL: Fibroblast growth factor receptor 2

Crystal Structure of FGF Receptor 2 Tyrosine Kinase Domain Harboring the D650V Activating Mutation. Determined by X-ray diffraction at 1.86 Å resolution. Released 22 Feb 2017.

Method: X-ray diffraction
Resolution: 1.86 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,705
Mol. weight: 75.39 kDa
Ligands: ANP
Released: 22 Feb 2017

Explore 5UGL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UGL contains 36 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	475	1	6
α-helix	478-480	3
β-strand	481-489	9	6
β-strand	494-501	8	6
β-strand	511-518	8	6
β-strand	524	1	5
α-helix	525-540	16
β-strand	547	1	7
α-helix	548-549	2
β-strand	550-554	5	6
β-strand	561-565	5	6
β-strand	571	1	7
α-helix	572-577	6
α-helix	600-619	20
β-strand	622-623	2	8
α-helix	629-631	3
β-strand	632-634	3	7
β-strand	640-642	3	7
α-helix	645-647	3
β-strand	649-650	2	8
α-helix	655	1
β-strand	656-657	2	9
β-strand	666	1	2
α-helix	667-669	3
α-helix	672-677	6
β-strand	679-680	2	9
α-helix	682-697	16
α-helix	701-702	2
α-helix	709-717	9
α-helix	722-725	4
α-helix	730-739	10
α-helix	744-746	3
α-helix	748-749	2
α-helix	750-762	13

Chain B: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	468-470	3
β-strand	475	1	1
α-helix	478-480	3
β-strand	481-489	9	1
β-strand	494-501	8	1
β-strand	511-518	8	1
β-strand	524	1	2
α-helix	525-540	16
β-strand	547	1	3
α-helix	548-549	2
β-strand	550-554	5	1
β-strand	561-565	5	1
β-strand	571	1	3
α-helix	572-577	6
α-helix	600-619	20
β-strand	622-623	2	4
α-helix	629-631	3
β-strand	632-634	3	3
β-strand	640-642	3	3
α-helix	645-647	3
β-strand	649-650	2	4
β-strand	666	1	5
α-helix	667-669	3
α-helix	672-677	6
α-helix	682-697	16
α-helix	701-702	2
α-helix	709-717	9
α-helix	722-725	4
α-helix	730-739	10
α-helix	744-746	3
α-helix	748-749	2
α-helix	750-762	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibroblast growth factor receptor 2	A, B	protein	324	Homo sapiens	P21802 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5UGL_1 Fibroblast growth factor receptor 2 (chains A, B)
MGSSHHHHHHSQDPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGID
KDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIV
EYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIH
RDLAARNVLVTENNVMKIADFGLARVINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQS
DVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVP
SQRPTFKQLVEDLDRILTLTTNEE

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Elucidation of a four-site allosteric network in fibroblast growth factor receptor tyrosine kinases. Chen, H., Marsiglia, W.M., Cho, M.K. et al. Elife (2017) 6. DOI 10.7554/eLife.21137 · PubMed

Other PDB entries of the same protein (UniProt P21802 (AlphaFold model), which also has an AlphaFold model), best resolution first:

10OU 1.77 Å, FGFR2 mutant D650V with compound 12
2PVF 1.8 Å, Crystal Structure of Tyrosine Phosphorylated Activated FGF Receptor 2 (FGFR2) Kinase…
3B2T 1.8 Å, Structure of phosphotransferase
4J99 1.85 Å, Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Gain-of-Function…
10OO 1.85 Å, FGFR2 mutant D650V with compound 4 (AZD3463)
3CAF 1.96 Å, Crystal Structure of hFGFR2 D2 Domain
10OQ 1.98 Å, FGFR2 mutant D650V with compound 6
9U7S 1.99 Å, FGFR2 kinase domain with a macrocyclic compound 8r
3CLY 2.0 Å, Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domains Trapped in…
8W3D 2.04 Å, TAS-120 covalent structure with FGFR2 molecular brake mutant
5UI0 2.05 Å, Crystal Structure of the Tyrosine Kinase Domain of FGF Receptor 2 harboring an…
3OJM 2.1 Å, Crystal Structure of FGF1 complexed with the ectodomain of FGFR2b harboring P253R Apert…

Browse structure collections

About this viewer

MolViewer shows 5UGL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.