5UJ7: Origin recognition complex subunit 1

Structure of the active form of human Origin Recognition Complex ATPase motor module, complex subunitS 1, 4, 5. Determined by X-ray diffraction at 3.39 Å resolution. Released 8 Feb 2017.

Method: X-ray diffraction
Resolution: 3.39 Å
Organism: Homo sapiens
Chains: 6
Atoms: 15,870
Mol. weight: 258.74 kDa
Ligands: ATP, MG
Released: 8 Feb 2017

Explore 5UJ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UJ7 contains 116 α-helices and 48 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	494-497	4
α-helix	509-523	15
β-strand	528-534	7	1
α-helix	540-556	17
β-strand	565-569	5	1
α-helix	578-586	9
α-helix	594-604	11
β-strand	616-620	5	1
α-helix	622-625	4
α-helix	631-638	8
α-helix	639-641	3
β-strand	648-652	5	1
α-helix	658-660	3
β-strand	675-678	4	1
α-helix	679-681	3
α-helix	683-692	10
α-helix	706-712	7
α-helix	720-734	15
α-helix	748-756	9
α-helix	762-769	8
α-helix	772-788	17
β-strand	793-794	2	2
α-helix	795-808	14
α-helix	811-813	3
α-helix	816-828	13
β-strand	832-834	3	2
α-helix	837-842	6
β-strand	844-847	4	2
α-helix	851-859	9

Chain B: 22 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	494-497	4
α-helix	509-523	15
β-strand	528-534	7	7
α-helix	540-556	17
β-strand	565-569	5	7
α-helix	570-572	3
α-helix	578-586	9
α-helix	594-604	11
β-strand	616-620	5	7
α-helix	622-625	4
α-helix	631-638	8
α-helix	639-641	3
β-strand	648-652	5	7
α-helix	658-660	3
β-strand	675-678	4	7
α-helix	679-680	2
β-strand	681	1	8
α-helix	683-692	10
α-helix	706-712	7
β-strand	717	1	8
α-helix	720-734	15
α-helix	748-756	9
α-helix	762-769	8
α-helix	772-788	17
β-strand	793-794	2	9
α-helix	795-808	14
α-helix	811-813	3
α-helix	816-828	13
β-strand	832-834	3	9
α-helix	837-842	6
β-strand	844-847	4	9
α-helix	851-858	8

Chain C: 22 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	19-28	10
α-helix	41-55	15
β-strand	61-66	6	3
α-helix	73-85	13
α-helix	88-93	6
β-strand	95-100	6	3
α-helix	107-117	11
α-helix	132-140	9
β-strand	154-159	6	3
α-helix	161-164	4
α-helix	171-182	12
β-strand	187-193	7	3
α-helix	198-201	4
α-helix	204-209	6
α-helix	211	1
β-strand	215-217	3	3
α-helix	223-234	12
α-helix	245-257	13
α-helix	260-270	11
α-helix	276-288	13
β-strand	291	1	4
β-strand	294	1	4
α-helix	299-310	12
α-helix	313-319	7
α-helix	323-338	16
β-strand	344	1	5
α-helix	346-357	12
α-helix	369-381	13
β-strand	385-387	3	5
β-strand	402-404	3	5
α-helix	408-417	10
α-helix	423-429	7

Chain D: 21 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	19-28	10
α-helix	41-56	16
β-strand	61-66	6	10
α-helix	73-85	13
α-helix	88-93	6
β-strand	95-100	6	10
α-helix	107-117	11
α-helix	132-140	9
β-strand	154-159	6	10
α-helix	161-164	4
α-helix	171-181	11
β-strand	187-193	7	10
α-helix	198-201	4
α-helix	204-209	6
β-strand	215-217	3	10
α-helix	223-234	12
α-helix	245-257	13
α-helix	260-270	11
α-helix	276-288	13
β-strand	291	1	11
β-strand	294	1	11
α-helix	299-310	12
α-helix	313-319	7
α-helix	323-338	16
β-strand	344	1	12
α-helix	346-356	11
α-helix	369-381	13
β-strand	385-387	3	12
β-strand	402-404	3	12
α-helix	408-417	10
α-helix	423-431	9

Chain E: 15 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	12-22	11
β-strand	32-36	5	6
α-helix	39-41	3
α-helix	43-53	11
β-strand	58-62	5	6
α-helix	69-78	10
α-helix	100-108	9
β-strand	120-125	6	6
α-helix	127-132	6
α-helix	137-142	6
α-helix	144-148	5
β-strand	152-158	7	6
α-helix	162-164	3
β-strand	175-178	4	6
α-helix	180-182	3
α-helix	184-191	8
α-helix	201-215	15
α-helix	222-231	10
α-helix	233-241	9
α-helix	254-265	12

Chain F: 15 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	12-22	11
β-strand	32-36	5	13
α-helix	39-41	3
α-helix	43-53	11
β-strand	58-62	5	13
α-helix	69-78	10
α-helix	100-108	9
β-strand	120-125	6	13
α-helix	127-132	6
α-helix	137-142	6
α-helix	144-148	5
β-strand	152-157	6	13
α-helix	162-164	3
β-strand	175-178	4	13
α-helix	180-182	3
α-helix	184-193	10
α-helix	201-215	15
α-helix	222-231	10
α-helix	233-241	9
α-helix	254-265	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Origin recognition complex subunit 1	A, B	protein	391	Homo sapiens	Q13415 (AlphaFold model)
Origin recognition complex subunit 4	C, D	protein	436	Homo sapiens	O43929 (AlphaFold model)
Origin recognition complex subunit 5	E, F	protein	284	Homo sapiens	O43913 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5UJ7_1 Origin recognition complex subunit 1 (chains A, B)
APQIRSRSLAAQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCM
YISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQ
KATANHAAELLAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVL
AIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVAR
KVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAIKNS
SVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCR
LLLVEPSRNDLLLRVRLNVSQDDVLYALKDE

Sequence of entity 2 (C, D), FASTA

>5UJ7_2 Origin recognition complex subunit 4 (chains C, D)
MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGES
NSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNL
ENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDIS
QSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEF
PDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAV
DLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRK
AHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPN
CPTDVRQWATSSLSWL

Sequence of entity 3 (E, F), FASTA

>5UJ7_3 Origin recognition complex subunit 5 (chains E, F)
MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVF
VNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTV
YIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFP
DYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPV
VKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKD

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	6
MG	Magnesium ion	Mg	4

Water and common crystallization additives (K) are not listed.

Primary citation

Structure of the active form of human Origin Recognition Complex and its ATPase motor module. Tocilj, A., On, K.F., Yuan, Z. et al. Elife (2017) 6. DOI 10.7554/eLife.20818 · PubMed

Other PDB entries of the same protein (UniProt Q13415 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6P3W 2.54 Å, Crystal structure of the Cyclin A-CDK2-ORC1 complex
11RL 2.8 Å, CryoEM structure of the human origin recognition complex with DNA and CDC6 protein
7JPO 3.2 Å, ORC-O1AAA: Human Origin Recognition Complex (ORC) with dynamic/unresolved ORC2 WH
8S0D 3.6 Å, H. sapiens MCM bound to double stranded DNA and ORC1-6
7JPP 3.7 Å, ORC-O2WH: Human Origin Recognition Complex (ORC) with dynamic/unresolved ORC1 AAA+ domain
8S0E 3.8 Å, H. sapiens OCCM bound to double stranded DNA
7JPR 4.0 Å, ORC-OPEN: Human Origin Recognition Complex (ORC) in an open conformation
8S0C 4.0 Å, H. sapiens ORC1-5 bound to double stranded DNA as part of the MCM-ORC complex
8S0F 4.1 Å, H. sapiens OC1M bound to double stranded DNA
7JPS 4.4 Å, ORC-DNA: Human Origin Recognition Complex (ORC) with DNA bound in the core
7CTF 4.8 Å, Human origin recognition complex 1-5 State II
7CTG 5.0 Å, Human Origin Recognition Complex, ORC1-5 State I

Browse structure collections

About this viewer

MolViewer shows 5UJ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.