5UJM: Origin recognition complex subunit 1

Structure of the active form of human Origin Recognition Complex and its ATPase motor module. Determined by electron microscopy at 18.0 Å resolution. Released 8 Feb 2017.

Method: Electron microscopy
Resolution: 18.0 Å
Organism: Homo sapiens
Chains: 5
Atoms: 15,673
Mol. weight: 283.84 kDa
Ligands: ATP, MG
Released: 8 Feb 2017

Explore 5UJM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UJM contains 117 α-helices and 48 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	494-497	4
α-helix	509-523	15
β-strand	528-534	7	1
α-helix	540-556	17
β-strand	565-569	5	1
α-helix	578-586	9
α-helix	594-604	11
β-strand	616-620	5	1
α-helix	622-625	4
α-helix	631-638	8
α-helix	639-641	3
β-strand	648-652	5	1
α-helix	658-660	3
β-strand	675-678	4	1
α-helix	679-681	3
α-helix	683-692	10
α-helix	706-712	7
α-helix	720-734	15
α-helix	748-756	9
α-helix	762-769	8
α-helix	772-788	17
β-strand	793-794	2	2
α-helix	795-808	14
α-helix	811-813	3
α-helix	816-828	13
β-strand	832-834	3	2
α-helix	837-842	6
β-strand	844-847	4	2
α-helix	851-859	9

Chain B: 15 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	286-307	22
β-strand	310-314	5	3
α-helix	320-325	6
α-helix	326-331	6
β-strand	336-340	5	3
α-helix	348-354	7
α-helix	355-359	5
α-helix	365-366	2
α-helix	369-380	12
β-strand	388-393	6	3
α-helix	405-414	10
β-strand	418-424	7	3
α-helix	429-432	4
α-helix	435-440	6
β-strand	443-446	4	3
α-helix	474-481	8
α-helix	486-501	16
β-strand	511	1	4
α-helix	513-522	10
α-helix	529-541	13
β-strand	546-549	4	4
β-strand	555-558	4	4
α-helix	563-573	11

Chain C: 36 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	42-80	39
β-strand	103-104	2	5
β-strand	107	1	6
α-helix	112-114	3
α-helix	115-127	13
β-strand	134-136	3	5
α-helix	145-157	13
α-helix	161-163	3
α-helix	190-192	3
α-helix	197-200	4
α-helix	201-205	5
α-helix	212-214	3
β-strand	216	1	7
β-strand	217-219	3	5
α-helix	227-239	13
β-strand	247	1	7
β-strand	249-250	2	5
α-helix	256-262	7
α-helix	265-270	6
β-strand	274-275	2	5
β-strand	278	1	6
α-helix	281-288	8
α-helix	289-293	5
β-strand	301-302	2	8
α-helix	304-312	9
α-helix	313-317	5
α-helix	321-336	16
α-helix	340-344	5
α-helix	348-357	10
α-helix	360-366	7
α-helix	373-377	5
α-helix	382-388	7
α-helix	391-423	33
α-helix	435-444	10
α-helix	451-463	13
α-helix	465-481	17
α-helix	482-486	5
α-helix	493-505	13
α-helix	549-556	8
α-helix	557-564	8
β-strand	578	1	8
β-strand	581-582	2	8
α-helix	585-591	7
α-helix	596-605	10
α-helix	629-639	11
α-helix	646-650	5
α-helix	652-656	5
α-helix	679-690	12
β-strand	696-697	2	9
β-strand	703-704	2	9

Chain D: 22 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	19-28	10
α-helix	41-55	15
β-strand	61-66	6	10
α-helix	73-85	13
α-helix	88-93	6
β-strand	95-100	6	10
α-helix	107-117	11
α-helix	132-140	9
β-strand	154-159	6	10
α-helix	161-164	4
α-helix	171-182	12
β-strand	187-193	7	10
α-helix	198-201	4
α-helix	204-209	6
α-helix	211	1
β-strand	215-217	3	10
α-helix	223-234	12
α-helix	245-257	13
α-helix	260-270	11
α-helix	276-288	13
β-strand	291	1	11
β-strand	294	1	11
α-helix	299-310	12
α-helix	313-319	7
α-helix	323-338	16
β-strand	344	1	12
α-helix	346-357	12
α-helix	369-381	13
β-strand	385-387	3	12
β-strand	402-404	3	12
α-helix	408-417	10
α-helix	423-429	7

Chain E: 23 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	12-22	11
β-strand	32-36	5	13
α-helix	39-41	3
α-helix	43-53	11
β-strand	58-62	5	13
α-helix	69-78	10
α-helix	100-108	9
β-strand	120-125	6	13
α-helix	127-132	6
α-helix	137-142	6
α-helix	144-148	5
β-strand	152-158	7	13
α-helix	162-164	3
β-strand	175-178	4	13
α-helix	180-182	3
α-helix	184-191	8
α-helix	201-215	15
α-helix	222-231	10
α-helix	233-241	9
α-helix	254-265	12
α-helix	304-318	15
α-helix	321-323	3
α-helix	324-327	4
β-strand	356-357	2	14
α-helix	359-370	12
α-helix	374-376	3
α-helix	378-389	12
β-strand	393-395	3	14
β-strand	407-409	3	14
α-helix	414-423	10
α-helix	427-430	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Origin recognition complex subunit 1	A	protein	522	Homo sapiens	Q13415 (AlphaFold model)
Origin recognition complex subunit 2	B	protein	347	Homo sapiens	Q13416 (AlphaFold model)
Origin recognition complex subunit 3	C	protein	712	Homo sapiens	Q9UBD5 (AlphaFold model)
Origin recognition complex subunit 4	D	protein	436	Homo sapiens	O43929 (AlphaFold model)
Origin recognition complex subunit 5	E	protein	435	Homo sapiens	O43913

Sequence of entity 1 (A), FASTA

>5UJM_1 Origin recognition complex subunit 1 (chains A)
MSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKTGSLQDSEVNQEAKPEVKPEVKPETHINL
KVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLTFLYDGIEIQADQTPEDLDMEDN
DIIEAHREQIGAPQIRSRSLAAQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVE
SKLLDHTGGCMYISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQV
YVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDELDILWTHKQDIMYNLFDW
PTHKEARLVVLAIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKA
FEDDAIQLVARKVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMF
SSSYITAIKNSSVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSET
MAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKDE

Sequence of entity 2 (B), FASTA

>5UJM_2 Origin recognition complex subunit 2 (chains B)
MKRDKTSDLVEEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQL
NQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKS
VLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIG
QLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSG
SLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDL
TLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA

Sequence of entity 3 (C), FASTA

>5UJM_3 Origin recognition complex subunit 3 (chains C)
MATSSMSKGCFVFKPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENER
LQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGS
LTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYS
MDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQH
LHEFPLILIFGIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPF
KINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSN
NQCENIRRLPSFRRYVEKQASEKQVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLH
KFTSSLPKYPLGRQIRELYCTCLEKNIWDSEEYASVLQLLRMLAKDELMTILEKCFKVFK
SYCENHLGSTAKRIEEFLAQFQSLDAETKEEEDASGSQPKGLQKTDLYHLQKSLLEMKEL
RRSKKQTKFEVLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIAL
HTALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAA
EKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC

Sequence of entity 4 (D), FASTA

>5UJM_4 Origin recognition complex subunit 4 (chains D)
MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGES
NSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNL
ENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDIS
QSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEF
PDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAV
DLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRK
AHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPN
CPTDVRQWATSSLSWL

Sequence of entity 5 (E), FASTA

>5UJM_5 Origin recognition complex subunit 5 (chains E)
MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVF
VNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTV
YIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFP
DYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPV
VKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHV
ELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLD
RLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIA
RTVNFDIIKYLYDFL

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	3
MG	Magnesium ion	Mg	2

Primary citation

Structure of the active form of human Origin Recognition Complex and its ATPase motor module. Tocilj, A., On, K.F., Yuan, Z. et al. Elife (2017) 6. DOI 10.7554/eLife.20818 · PubMed

Other PDB entries of the same protein (UniProt Q13415 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6P3W 2.54 Å, Crystal structure of the Cyclin A-CDK2-ORC1 complex
11RL 2.8 Å, CryoEM structure of the human origin recognition complex with DNA and CDC6 protein
7JPO 3.2 Å, ORC-O1AAA: Human Origin Recognition Complex (ORC) with dynamic/unresolved ORC2 WH
5UJ7 3.39 Å, Structure of the active form of human Origin Recognition Complex ATPase motor module,…
8S0D 3.6 Å, H. sapiens MCM bound to double stranded DNA and ORC1-6
7JPP 3.7 Å, ORC-O2WH: Human Origin Recognition Complex (ORC) with dynamic/unresolved ORC1 AAA+ domain
8S0E 3.8 Å, H. sapiens OCCM bound to double stranded DNA
7JPR 4.0 Å, ORC-OPEN: Human Origin Recognition Complex (ORC) in an open conformation
8S0C 4.0 Å, H. sapiens ORC1-5 bound to double stranded DNA as part of the MCM-ORC complex
8S0F 4.1 Å, H. sapiens OC1M bound to double stranded DNA
7JPS 4.4 Å, ORC-DNA: Human Origin Recognition Complex (ORC) with DNA bound in the core
7CTF 4.8 Å, Human origin recognition complex 1-5 State II

Browse structure collections

About this viewer

MolViewer shows 5UJM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.