5VOK: C7orf59-HBXIP dimer
Crystal structure of the C7orf59-HBXIP dimer. Determined by X-ray diffraction at 2.89 Å resolution. Released 23 May 2018.
- Method
- X-ray diffraction
- Resolution
- 2.89 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 5,252
- Mol. weight
- 82.7 kDa
- Released
- 23 May 2018
Explore 5VOK in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5VOK contains 16 α-helices and 40 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-12 | 8 | |
| β-strand | 20-24 | 5 | 1 |
| β-strand | 33-34 | 2 | 1 |
| α-helix | 40-52 | 13 | |
| β-strand | 64 | 1 | 2 |
| β-strand | 76-79 | 4 | 1 |
| β-strand | 82-87 | 6 | 1 |
Chain B: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-14 | 2 | |
| β-strand | 15-22 | 8 | 2 |
| β-strand | 26-31 | 6 | 2 |
| α-helix | 37-50 | 14 | |
| β-strand | 66-69 | 4 | 2 |
| β-strand | 73-79 | 7 | 2 |
| β-strand | 83-90 | 8 | 2 |
Chain C: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-13 | 9 | |
| β-strand | 18-24 | 7 | 3 |
| β-strand | 33-35 | 3 | 3 |
| α-helix | 42-53 | 12 | |
| β-strand | 64-68 | 5 | 3 |
| β-strand | 73-79 | 7 | 3 |
| β-strand | 82-88 | 7 | 3 |
Chain D: 1 helix, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 17-22 | 6 | 3 |
| β-strand | 25-30 | 6 | 3 |
| α-helix | 37-51 | 15 | |
| β-strand | 65-69 | 5 | 3 |
| β-strand | 74-79 | 6 | 3 |
| β-strand | 84-89 | 6 | 3 |
Chain E: 3 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-13 | 9 | |
| β-strand | 20-24 | 5 | 4 |
| β-strand | 30-35 | 6 | 4 |
| α-helix | 41-52 | 12 | |
| α-helix | 62-63 | 2 | |
| β-strand | 64-68 | 5 | 4 |
| β-strand | 74-77 | 4 | 4 |
| β-strand | 83-87 | 5 | 4 |
Chain F: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-15 | 3 | |
| β-strand | 17-22 | 6 | 4 |
| β-strand | 25-31 | 7 | 4 |
| α-helix | 40-52 | 13 | |
| β-strand | 65-69 | 5 | 4 |
| β-strand | 74-80 | 7 | 4 |
| β-strand | 83-89 | 7 | 4 |
Chain G: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-14 | 10 | |
| β-strand | 18-24 | 7 | 5 |
| β-strand | 30-35 | 6 | 5 |
| α-helix | 39-55 | 17 | |
| β-strand | 64-68 | 5 | 5 |
| β-strand | 73-80 | 8 | 5 |
| β-strand | 82-88 | 7 | 5 |
Chain H: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 15-21 | 7 | 5 |
| β-strand | 26-31 | 6 | 5 |
| α-helix | 38-49 | 12 | |
| β-strand | 65-69 | 5 | 5 |
| β-strand | 73-80 | 8 | 5 |
| β-strand | 83-90 | 8 | 5 |
| α-helix | 91 | 1 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Ragulator complex protein LAMTOR5 | A, C, E, G | protein | 91 | Homo sapiens | O43504 (AlphaFold model) |
| Ragulator complex protein LAMTOR4 | B, D, F, H | protein | 103 | Homo sapiens | Q0VGL1 (AlphaFold model) |
Sequence of entity 1 (A, C, E, G), FASTA
>5VOK_1 Ragulator complex protein LAMTOR5 (chains A, C, E, G)
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPT
DIPVVCLESDNGNIMIQKHDGITVAVHKMAS
Sequence of entity 2 (B, D, F, H), FASTA
>5VOK_2 Ragulator complex protein LAMTOR4 (chains B, D, F, H)
GPGSMTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLH
RGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
Primary citation
C7orf59/Lamtor4 phosphorylation and structural flexibility modulate Ragulator assembly. Rasheed, N., Lima, T.B., Mercaldi, G.F. et al. FEBS Open Bio (2019). DOI 10.1002/2211-5463.12700 · PubMed
Other PDB entries of the same protein (UniProt O43504 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6B9X 1.42 Å, Crystal structure of Ragulator
- 3MSH 1.51 Å, Crystal structure of Hepatitis B X-Interacting Protein at high resolution
- 5X6V 2.02 Å, Crystal structure of human heteroheptameric complex
- 5YK5 2.03 Å, structure of the human Lamtor4-Lamtor5 complex
- 3MS6 2.08 Å, Crystal structure of Hepatitis B X-Interacting Protein (HBXIP)
- 6EHP 2.3 Å, The crystal structure of the human LAMTOR complex
- 5X6U 2.4 Å, Crystal structure of human heteropentameric complex
- 5Y39 2.65 Å, Crystal structure of Ragulator complex (p18 76-145)
- 5Y38 2.8 Å, Crystal structure of C7orf59-HBXIP complex
- 6EHR 2.9 Å, The crystal structure of the human LAMTOR-RagA CTD-RagC CTD complex
- 5Y3A 2.9 Å, Crystal structure of Ragulator complex (p18 49-161)
- 7UX2 2.9 Å, cryo-EM structure of the Raptor-TFEB-Rag-Ragulator complex
Browse structure collections
About this viewer
MolViewer shows 5VOK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.