5VWI: Human Scribble PDZ1:Beta-PIX complex

Crystal structure of human Scribble PDZ1:Beta-PIX complex. Determined by X-ray diffraction at 1.75 Å resolution. Released 8 Nov 2017.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,617
Mol. weight: 22.06 kDa
Released: 8 Nov 2017

Explore 5VWI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5VWI contains 5 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	26-30	5	1
β-strand	46-51	6	1
α-helix	56-59	4
α-helix	66	1
β-strand	67-71	5	1
β-strand	74-75	2	1
α-helix	81-88	8
β-strand	94-100	7	1

Chain B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	11-17	7	2
β-strand	26-29	4	2
β-strand	46-51	6	2
α-helix	56-60	5
β-strand	67-71	5	2
β-strand	74-75	2	2
α-helix	81-88	8
β-strand	95-101	7	2

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	15-16	2	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	14-16	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein scribble homolog	A, B	protein	96	Homo sapiens	Q14160 (AlphaFold model)
beta-PIX	C, D	protein	8	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>5VWI_1 Protein scribble homolog (chains A, B)
GPLGSVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGD
RILAVNGQDVRDATHQEAVSALLRPCLELSLLVRRD

Sequence of entity 2 (C, D), FASTA

>5VWI_2 beta-PIX (chains C, D)
PAWDETNL

Primary citation

Structural basis for the differential interaction of Scribble PDZ domains with the guanine nucleotide exchange factor beta-PIX. Lim, K.Y.B., Godde, N.J., Humbert, P.O. et al. J Biol Chem (2017) 292:20425-20436. DOI 10.1074/jbc.M117.799452 · PubMed

Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MYE 1.1 Å, Crystal structure of human Scribble PDZ1 domain in complex with internal PDZ binding…
6EEY 1.15 Å, Crystal structure of human Scribble PDZ4 R1110G Mutant
2W4F 1.3 Å, Crystal structure of the first PDZ domain of human SCRIB1
6MS1 1.35 Å, Crystal structure of the human Scribble PDZ1 domain bound to the PDZ-binding motif of APC
6MYF 1.6 Å, Crystal structure of free human Scribble PDZ1 domain
7QRS 1.77 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QS9 1.8 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QSB 1.84 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QS8 1.85 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QRT 1.9 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QTP 1.9 Å, Structural biology of the NS1 avian influenza protein subversion on the Scribble cell…
8CD3 1.9 Å, Crystal structure of human Scribble PDZ1 domain in complex with human TMIGD1

Browse structure collections

About this viewer

MolViewer shows 5VWI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.