6EEY: Human Scribble PDZ4 R1110G Mutant

Crystal structure of human Scribble PDZ4 R1110G Mutant. Determined by X-ray diffraction at 1.15 Å resolution. Released 2 Oct 2019.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: Homo sapiens
Chains: 1
Atoms: 823
Mol. weight: 9.98 kDa
Released: 2 Oct 2019

Explore 6EEY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EEY contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1099-1104	6	1
β-strand	1113-1117	5	1
α-helix	1129-1131	3
β-strand	1134-1139	6	1
α-helix	1144-1148	5
β-strand	1156-1160	5	1
β-strand	1163-1164	2	1
α-helix	1170-1177	8
β-strand	1183-1188	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein scribble homolog	A	protein	95	Homo sapiens	Q14160 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6EEY_1 Protein scribble homolog (chains A)
SHMLRELCIQKAPGEGLGISIRGGARGHAGNPRDPTDEGIFISKVSPTGAAGRDGRLRVG
LRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVC

Primary citation

Scribble co-operatively binds multiple alpha1D-adrenergic receptor C-terminal PDZ ligands. Janezic, E.M., Harris, D.A., Dinh, D. et al. Sci Rep (2019) 9:14073-14073. DOI 10.1038/s41598-019-50671-6 · PubMed

Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MYE 1.1 Å, Crystal structure of human Scribble PDZ1 domain in complex with internal PDZ binding…
2W4F 1.3 Å, Crystal structure of the first PDZ domain of human SCRIB1
6MS1 1.35 Å, Crystal structure of the human Scribble PDZ1 domain bound to the PDZ-binding motif of APC
6MYF 1.6 Å, Crystal structure of free human Scribble PDZ1 domain
5VWI 1.75 Å, Crystal structure of human Scribble PDZ1:Beta-PIX complex
7QRS 1.77 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QS9 1.8 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QSB 1.84 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QS8 1.85 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QRT 1.9 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QTP 1.9 Å, Structural biology of the NS1 avian influenza protein subversion on the Scribble cell…
8CD3 1.9 Å, Crystal structure of human Scribble PDZ1 domain in complex with human TMIGD1

Browse structure collections

About this viewer

MolViewer shows 6EEY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.