7QS9: Protein scribble homolog

Structural basis on the interaction of Scribble PDZ domains with the Tick Born encephalitis virus (TBEV) NS5 protein. Determined by X-ray diffraction at 1.8 Å resolution. Released 31 Aug 2022.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Homo sapiens, Tick-borne encephalitis virus
Chains: 4
Atoms: 1,543
Mol. weight: 27.51 kDa
Released: 31 Aug 2022

Explore 7QS9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QS9 contains 4 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	725-732	8	1
β-strand	740-744	5	1
β-strand	746	1	2
β-strand	752	1	3
β-strand	755	1	3
β-strand	758-763	6	1
α-helix	768-771	4
β-strand	779-783	5	1
β-strand	786-787	2	1
β-strand	792	1	2
α-helix	793-801	9
β-strand	806-813	8	1

Chain B: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	725-732	8	4
β-strand	740-744	5	4
β-strand	746	1	5
β-strand	752	1	6
β-strand	755	1	6
β-strand	758-763	6	4
α-helix	768-772	5
β-strand	779-783	5	4
β-strand	786-787	2	4
β-strand	792	1	5
α-helix	793-801	9
β-strand	806-813	8	4

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	311-313	3	1

Chain E: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	15-17	3	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein scribble homolog	A, B	protein	122	Homo sapiens	Q14160 (AlphaFold model)
RNA-directed RNA polymerase NS5	C, E	protein	8	Tick-borne encephalitis virus	Q01299

Sequence of entity 1 (A, B), FASTA

>7QS9_1 Protein scribble homolog (chains A, B)
GPLGSSAPSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGD
DEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRE
RM

Sequence of entity 2 (C, E), FASTA

>7QS9_2 RNA-directed RNA polymerase NS5 (chains C, E)
EMYYSTAV

Primary citation

Molecular basis of Tick Born encephalitis virus NS5 mediated subversion of apico-basal cell polarity signalling. Javorsky, A., Humbert, P.O., Kvansakul, M. Biochem J (2022) 479:1303-1315. DOI 10.1042/BCJ20220037 · PubMed

Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:

Browse structure collections

About this viewer

MolViewer shows 7QS9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.