7QRT: Protein scribble homolog

Structural insight into the Scribble PDZ domains interaction with the oncogenic Human T-cell lymphotrophic virus-1 (HTLV-1) Tax1. Determined by X-ray diffraction at 1.9 Å resolution. Released 7 Sept 2022.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Homo sapiens, Human T-cell leukemia virus type I
Chains: 3
Atoms: 1,542
Mol. weight: 20.46 kDa
Released: 7 Sept 2022

Explore 7QRT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QRT contains 4 α-helices and 18 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	26-30	5	1
β-strand	38	1	2
β-strand	41	1	2
β-strand	44-50	7	1
α-helix	54-58	5
β-strand	66-70	5	1
β-strand	73-74	2	1
α-helix	80-88	9
β-strand	93-99	7	1

Chain B: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	20-24	5	3
β-strand	26-30	5	1
β-strand	38	1	4
β-strand	41	1	4
β-strand	44-49	6	1
α-helix	54-58	5
β-strand	66-70	5	1
β-strand	73-74	2	1
α-helix	80-88	9
β-strand	93-99	7	1

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	459-461	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein scribble homolog	A, B	protein	92	Homo sapiens	Q14160 (AlphaFold model)
Protein Tax-1	C	protein	8	Human T-cell leukemia virus type I	P14079

Sequence of entity 1 (A, B), FASTA

>7QRT_1 Protein scribble homolog (chains A, B)
SRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEGGAAHRAGTLQVGDRVLSI
NGVDVTEARHDHAVSLLTAASPTIALLLEREA

Sequence of entity 2 (C), FASTA

>7QRT_2 Protein Tax-1 (chains C)
KHFRETEV

Primary citation

Structural insight into the Scribble PDZ domains interaction with the oncogenic Human T-cell lymphotrophic virus-1 (HTLV-1) Tax1 PBM. Javorsky, A., Maddumage, J.C., Mackie, E.R.R. et al. FEBS J (2023) 290:974-987. DOI 10.1111/febs.16607 · PubMed

Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MYE 1.1 Å, Crystal structure of human Scribble PDZ1 domain in complex with internal PDZ binding…
6EEY 1.15 Å, Crystal structure of human Scribble PDZ4 R1110G Mutant
2W4F 1.3 Å, Crystal structure of the first PDZ domain of human SCRIB1
6MS1 1.35 Å, Crystal structure of the human Scribble PDZ1 domain bound to the PDZ-binding motif of APC
6MYF 1.6 Å, Crystal structure of free human Scribble PDZ1 domain
5VWI 1.75 Å, Crystal structure of human Scribble PDZ1:Beta-PIX complex
7QRS 1.77 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QS9 1.8 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QSB 1.84 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QS8 1.85 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QTP 1.9 Å, Structural biology of the NS1 avian influenza protein subversion on the Scribble cell…
8CD3 1.9 Å, Crystal structure of human Scribble PDZ1 domain in complex with human TMIGD1

Browse structure collections

About this viewer

MolViewer shows 7QRT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.