5W5Z: BAXP168G

Crystal structure of BAXP168G in complex with an activating antibody at high resolution. Determined by X-ray diffraction at 2.0 Å resolution. Released 27 Jun 2018.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 3
Atoms: 4,218
Mol. weight: 67.6 kDa
Released: 27 Jun 2018

Explore 5W5Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5W5Z contains 23 α-helices and 46 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	59-71	13
α-helix	91-99	9
α-helix	107-114	8
α-helix	144-148	5
α-helix	149-154	6
α-helix	159-166	8
α-helix	170-182	13

Chain H: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	7
β-strand	11-12	2	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-40	7	9
β-strand	44-52	9	9
β-strand	57-60	4	9
α-helix	62-64	3
β-strand	65	1	7
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-99	8	9
β-strand	105-108	4	9
β-strand	112-114	3	9
β-strand	115-116	2	8
α-helix	119-121	3
β-strand	122	1	10
α-helix	123-124	2
β-strand	125-129	5	11
β-strand	140-150	11	11
β-strand	151	1	10
β-strand	156-159	4	12
α-helix	160-162	3
β-strand	164	1	12
β-strand	168-170	3	11
α-helix	171-173	3
β-strand	174-176	3	11
β-strand	179-189	11	11
α-helix	190-195	6
β-strand	199-204	6	12
α-helix	205-207	3
β-strand	209-214	6	12

Chain L: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-48	4	2
β-strand	49	1	3
β-strand	53	1	3
α-helix	54-55	2
β-strand	62-66	5	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	85-90	6	2
β-strand	96-97	2	2
β-strand	101-105	5	2
β-strand	110	1	4
α-helix	111-112	2
β-strand	113-117	5	5
α-helix	118-120	3
α-helix	121-124	4
β-strand	128-138	11	5
β-strand	139	1	4
β-strand	144-149	6	6
β-strand	152-154	3	6
β-strand	158-162	5	5
α-helix	163-166	4
β-strand	172-181	10	5
α-helix	182-186	5
β-strand	190-196	7	6
β-strand	204-209	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
3C10 Fab light chain	L	protein	213	Rattus norvegicus
3C10 Fab heavy chain	H	protein	234	Rattus norvegicus
Apoptosis regulator BAX	A	protein	163	Homo sapiens	Q07812 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>5W5Z_1 3C10 Fab light chain (chains L)
DIQMTQSPSFLSASVGDRVTINCKASQNVNKYLDWYQQNLGEPPKLLIYHTNSLPTGIPS
RFSGSGSGTDFTLTISSLQVEDVATYFCLQHDSGLTFGSGTKLEIKRADAAPTVSIFPPS
MEQLTSGGATVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSL
TKVEYERHNLYTCEVVHKTSSSPVVKSFNRNEC

Sequence of entity 2 (H), FASTA

>5W5Z_2 3C10 Fab heavy chain (chains H)
QVQLQQSGAELVKPGSSVKISCKASGYTFTNYDMHWIKQRPGSGLEWIGWIYPGNGNTKY
NQKFNGKATLTADKSSTTAYMQLSSLTSEDSAVYFCVREGLGITFEYWGQGVKVTVSSAE
TTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLY
TLTSSVTVPSSTWSSQAVTCNVAHPASSTKVDKKIVPRECNPCGCTGSEVSSVF

Sequence of entity 3 (A), FASTA

>5W5Z_3 Apoptosis regulator BAX (chains A)
QDRAGRMGGEAPELALDPVPQDASTKKLSESLKRIGDELDSNMELQRMIAAVDTDSPREV
FFRVAADMFSDGNFNWGRVVALFYFASKLVLKALSTKVPELIRTIMGWTLDFLRERLLGW
IQDQGGWDGLLSYFGTGTWQTVTIFVAGVLTASLTIWKKMGSS

Primary citation

Ensemble Properties of Bax Determine Its Function. Robin, A.Y., Iyer, S., Birkinshaw, R.W. et al. Structure (2018) 26:1346. DOI 10.1016/j.str.2018.07.006 · PubMed

Other PDB entries of the same protein (UniProt Q07812 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZIE 1.8 Å, Crystal Structure of core/latch dimer of Bax in complex with BimBH3
5W60 1.8 Å, Crystal structure of BAXP168G monomer cryo-protected with ethylene glycol
4S0O 1.9 Å, Crystal Structure of the Autoinhibited Dimer of Pro-apoptotic BAX (I)
6EB6 2.02 Å, Crystal structure of BAX W139A monomer
8SRX 2.09 Å, Crystal structure of BAK-BAX heterodimer with lysoPC
8G1T 2.09 Å, Crystal structure of Bax core domain BH3-groove dimer - tetrameric fraction P21
6TRR 2.12 Å, Structural insight into tanapoxvirus mediated inhibition of apoptosis
4ZII 2.19 Å, Crystal Structure of core/latch dimer of BaxI66A in complex with BidBH3
4ZIG 2.2 Å, Crystal Structure of core/latch dimer of Bax in complex with BidBH3mini
8SPF 2.2 Å, Crystal structure of Bax core domain BH3-groove dimer - hexameric fraction with…
4BD2 2.21 Å, Bax domain swapped dimer in complex with BidBH3
7ADT 2.21 Å, Orf virus Apoptosis inhibitor ORFV125

Browse structure collections

About this viewer

MolViewer shows 5W5Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.