5W60: Apoptosis regulator BAX

Name: PDB 5W60: Crystal structure of BAXP168G monomer cryo-protected with ethylene glycol
Published: 2018-06-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Crystal structure of BAXP168G monomer cryo-protected with ethylene glycol. Determined by X-ray diffraction at 1.8 Å resolution. Released 27 Jun 2018.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,510
Mol. weight: 21.4 kDa
Released: 27 Jun 2018

Explore 5W60 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5W60 contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	16-34	19
α-helix	43-45	3
α-helix	46-48	3
α-helix	50-52	3
α-helix	54-71	18
α-helix	74-81	8
α-helix	89-99	11
α-helix	107-123	17
α-helix	129-143	15
α-helix	144-148	5
α-helix	149-154	6
α-helix	158-160	3
α-helix	161-165	5
α-helix	170-187	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis regulator BAX	A	protein	194	Homo sapiens	Q07812 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5W60_1 Apoptosis regulator BAX (chains A)
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ESLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALSTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTGTWQTVTIFVAGV
LTASLTIWKKMGSS

Primary citation

Ensemble Properties of Bax Determine Its Function. Robin, A.Y., Iyer, S., Birkinshaw, R.W. et al. Structure (2018) 26:1346. DOI 10.1016/j.str.2018.07.006 · PubMed

Other PDB entries of the same protein (UniProt Q07812 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZIE 1.8 Å, Crystal Structure of core/latch dimer of Bax in complex with BimBH3
4S0O 1.9 Å, Crystal Structure of the Autoinhibited Dimer of Pro-apoptotic BAX (I)
5W5Z 2.0 Å, Crystal structure of BAXP168G in complex with an activating antibody at high resolution
6EB6 2.02 Å, Crystal structure of BAX W139A monomer
8SRX 2.09 Å, Crystal structure of BAK-BAX heterodimer with lysoPC
8G1T 2.09 Å, Crystal structure of Bax core domain BH3-groove dimer - tetrameric fraction P21
6TRR 2.12 Å, Structural insight into tanapoxvirus mediated inhibition of apoptosis
4ZII 2.19 Å, Crystal Structure of core/latch dimer of BaxI66A in complex with BidBH3
4ZIG 2.2 Å, Crystal Structure of core/latch dimer of Bax in complex with BidBH3mini
8SPF 2.2 Å, Crystal structure of Bax core domain BH3-groove dimer - hexameric fraction with…
4BD2 2.21 Å, Bax domain swapped dimer in complex with BidBH3
7ADT 2.21 Å, Orf virus Apoptosis inhibitor ORFV125

Browse structure collections

About this viewer

MolViewer shows 5W60 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.