5W9A: Trim5alpha Bbox- coiled coil in complex LC3B

The structure of the Trim5alpha Bbox- coiled coil in complex LC3B. Determined by X-ray diffraction at 2.74 Å resolution. Released 10 Oct 2018.

Method: X-ray diffraction
Resolution: 2.74 Å
Organisms: Macaca mulatta, Homo sapiens
Chains: 4
Atoms: 4,849
Mol. weight: 73.4 kDa
Ligands: ZN
Released: 10 Oct 2018

Explore 5W9A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5W9A contains 21 α-helices and 23 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	96	1	1
β-strand	103	1	1
β-strand	106-108	3	2
α-helix	117-121	5
α-helix	123-125	3
β-strand	130-132	3	2
α-helix	133-242	110
α-helix	245-249	5
α-helix	252-260	9
α-helix	264-268	5
α-helix	282-286	5

Chain B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	96	1	7
β-strand	103	1	7
β-strand	106-108	3	8
β-strand	114-115	2	8
α-helix	117-121	5
β-strand	130-132	3	8
α-helix	133-242	110
α-helix	245-249	5
α-helix	252-260	9
α-helix	264-268	5
α-helix	282-286	5

Chains C and D: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	3
β-strand	51-55	5	3
β-strand	59	1	4
α-helix	60-70	11
β-strand	80-83	4	3
β-strand	86	1	3
β-strand	94	1	4
α-helix	95-102	8
β-strand	109-114	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tripartite motif-containing protein 5	A, B	protein	193	Macaca mulatta	Q0PF16 (AlphaFold model)
Microtubule-associated proteins 1A/1B light chain 3B	C, D	protein	114	Homo sapiens	Q9GZQ8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5W9A_1 Tripartite motif-containing protein 5 (chains A, B)
DHCARHGEKLLLFCQEDSKVICWLCKDSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQK
QQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILK
SLTKSETEMVQQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIENMTLKKPKTFHKNQ
RRVFRAPDLKGML

Sequence of entity 2 (C, D), FASTA

>5W9A_2 Microtubule-associated proteins 1A/1B light chain 3B (chains C, D)
EKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSEL
IKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

A helical LC3-interacting region mediates the interaction between the retroviral restriction factor Trim5 alpha and mammalian autophagy-related ATG8 proteins. Keown, J.R., Black, M.M., Ferron, A. et al. J Biol Chem (2018) 293:18378-18386. DOI 10.1074/jbc.RA118.004202 · PubMed

Other PDB entries of the same protein (UniProt Q0PF16 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UV9 1.55 Å, Structure of the rhesus monkey TRIM5alpha deltav1 PRYSPRY domain
5K3Q 1.8 Å, Rhesus macaques Trim5alpha Bbox2 domain
5EIU 1.91 Å, Mini TRIM5 B-box 2 dimer C2 crystal form
4TKP 2.08 Å, Complex of Ubc13 with the RING domain of the TRIM5alpha retroviral restriction factor
5F7T 2.29 Å, TRIM5 B-box2 and coiled-coil chimera
5IEA 3.26 Å, TRIM5 B-box2 and coiled-coil chimera
4B3N 3.3 Å, Crystal structure of rhesus TRIM5alpha PRY/SPRY domain
2LM3 Structure of the rhesus monkey TRIM5alpha PRYSPRY domain

Browse structure collections

About this viewer

MolViewer shows 5W9A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.