5WK3: Complex between CCL17 and M116 FAB

Crystal structure of the complex between CCL17 and M116 FAB. Determined by X-ray diffraction at 1.9 Å resolution. Released 20 Dec 2017.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 12
Atoms: 16,264
Mol. weight: 228.02 kDa
Released: 20 Dec 2017

Explore 5WK3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WK3 contains 101 α-helices and 192 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and D: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	21-23	3
β-strand	24-29	6	45
β-strand	39-43	5	45
β-strand	48-51	4	45
α-helix	56-69	14

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	21-23	3
β-strand	24-29	6	46
α-helix	30-31	2
β-strand	39-43	5	46
β-strand	48-51	4	46
α-helix	56-69	14

Chain C: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	21-23	3
β-strand	24-29	6	47
α-helix	30-31	2
β-strand	39-43	5	47
β-strand	48-51	4	47
α-helix	56-67	12

Chain P: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30-31	2	3
α-helix	32-34	3
β-strand	36-37	2	3
β-strand	39-44	6	2
β-strand	51-55	5	2
β-strand	59-60	2	2
α-helix	61	1
β-strand	68-73	6	1
β-strand	76-81	6	1
α-helix	86-88	3
β-strand	90-96	7	2
α-helix	103	1
β-strand	104	1	2
α-helix	105	1
β-strand	108-112	5	2
β-strand	117	1	4
β-strand	120-124	5	5
α-helix	125-127	3
α-helix	128-132	5
β-strand	135-145	11	5
β-strand	146	1	4
β-strand	151-156	6	6
β-strand	159-160	2	6
β-strand	165-169	5	5
α-helix	170-173	4
β-strand	179-188	10	5
α-helix	189-193	5
β-strand	197-203	7	6
β-strand	211-216	6	6

Chains Q and S: 12 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
α-helix	7-9	3
β-strand	10-12	3	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	45-52	8	8
β-strand	57-60	4	8
β-strand	69-73	5	7
α-helix	74-76	3
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-99	8	8
α-helix	100	1
β-strand	108-111	4	8
β-strand	115-119	5	8
β-strand	125	1	9
α-helix	126-127	2
β-strand	128-132	5	10
α-helix	133-135	3
α-helix	138-139	2
β-strand	143-153	11	10
β-strand	154	1	9
β-strand	159-162	4	11
α-helix	163-165	3
β-strand	167	1	11
β-strand	171-173	3	10
α-helix	174-176	3
β-strand	177-178	2	10
β-strand	184-193	10	10
α-helix	194-196	3
β-strand	203-208	6	11
α-helix	209-211	3
β-strand	213-218	6	11

Chains R and T: 11 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	12
β-strand	10-13	4	13
β-strand	19-25	7	12
β-strand	30-31	2	14
α-helix	32-34	3
β-strand	36-37	2	14
β-strand	39-44	6	13
β-strand	51-55	5	13
β-strand	59-60	2	13
α-helix	61	1
β-strand	68-73	6	12
β-strand	76-81	6	12
α-helix	86-88	3
β-strand	90-96	7	13
α-helix	103	1
β-strand	104	1	13
α-helix	105	1
β-strand	108-112	5	13
β-strand	117	1	15
α-helix	118-119	2
β-strand	120-124	5	16
α-helix	125-127	3
α-helix	128-131	4
β-strand	135-145	11	16
β-strand	146	1	15
β-strand	151-156	6	17
β-strand	159-160	2	17
α-helix	161	1
β-strand	165-169	5	16
α-helix	170-173	4
β-strand	179-188	10	16
α-helix	189-193	5
β-strand	197-203	7	17
β-strand	211-216	6	17

Chain U: 13 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	29
α-helix	7-9	3
β-strand	10-12	3	30
β-strand	18-25	8	29
α-helix	29-31	3
β-strand	34-39	6	30
β-strand	45-52	8	30
β-strand	57-60	4	30
β-strand	69-73	5	29
α-helix	74-76	3
β-strand	78-83	6	29
α-helix	88-90	3
β-strand	92-99	8	30
α-helix	100	1
β-strand	108-111	4	30
β-strand	115-119	5	30
α-helix	122-124	3
β-strand	125	1	31
α-helix	126-127	2
β-strand	128-132	5	32
α-helix	133-135	3
α-helix	138-139	2
β-strand	143-153	11	32
β-strand	154	1	31
β-strand	159-162	4	33
α-helix	163-165	3
β-strand	167	1	33
β-strand	171-173	3	32
α-helix	174-176	3
β-strand	177-178	2	32
β-strand	184-193	10	32
α-helix	194-196	3
β-strand	203-208	6	33
α-helix	209-211	3
β-strand	213-218	6	33

Chain V: 11 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	34
β-strand	10-13	4	35
β-strand	19-25	7	34
β-strand	30-31	2	36
α-helix	32-34	3
β-strand	36-37	2	36
β-strand	39-44	6	35
β-strand	51-55	5	35
β-strand	59-60	2	35
α-helix	61	1
β-strand	68-73	6	34
β-strand	76-81	6	34
α-helix	86-88	3
β-strand	90-96	7	35
α-helix	103	1
β-strand	104	1	35
α-helix	105	1
β-strand	108-112	5	35
β-strand	117	1	37
α-helix	118-119	2
β-strand	120-124	5	38
α-helix	125-127	3
α-helix	128-132	5
β-strand	135-145	11	38
β-strand	146	1	37
β-strand	151-156	6	39
β-strand	159-160	2	39
α-helix	161	1
β-strand	165-169	5	38
α-helix	170-173	4
β-strand	179-188	10	38
α-helix	189-193	5
β-strand	197-203	7	39
β-strand	211-216	6	39

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
M116 light chain	P, R, T, V	protein	220	Homo sapiens
M116 heavy chain	Q, S, U, W	protein	230	Homo sapiens
C-C motif chemokine 17	A, B, C, D	protein	71	Homo sapiens	Q92583 (AlphaFold model)

Sequence of entity 1 (P, R, T, V), FASTA

>5WK3_1 M116 LIGHT CHAIN (chains P, R, T, V)
DIVMTQSPDSLAVSLGERATINCKSSQSVLLSPWNSNQLAWYQQKPGQPPKLLIYGASTR
ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYLIPSTFGQGTKVEIKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS
LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (Q, S, U, W), FASTA

>5WK3_2 M116 HEAVY CHAIN (chains Q, S, U, W)
EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIDPSDSDTRY
SPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARVGPADVWDSFDYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCHHHHHH

Sequence of entity 3 (A, B, C, D), FASTA

>5WK3_3 C-C motif chemokine 17 (chains A, B, C, D)
ARGTNVTRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKN
AVKYLQSLERS

Primary citation

Structural insights into chemokine CCL17 recognition by antibody M116. Teplyakov, A., Obmolova, G., Gilliland, G.L. Biochem Biophys Rep (2018) 13:27-31. DOI 10.1016/j.bbrep.2017.11.005 · PubMed

Other PDB entries of the same protein (UniProt Q92583 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S4N 1.65 Å, Crystal structure of the tick evasin EVA-P974 complexed to human chemokine CCL17
1NR4 1.72 Å, High resolution crystal structures of thymus and activation-regulated chemokine
7SCV 2.01 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL17
8FJ2 2.07 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(C8) Complexed to Human Chemokine CCL17
8SKK 2.1 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL17
1NR2 2.18 Å, High resolution crystal structures of thymus and activation-regulated chemokine

Browse structure collections

About this viewer

MolViewer shows 5WK3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.