Crystal structure of human Importin4. Determined by X-ray diffraction at 3.22 Å resolution. Released 14 Feb 2018.
Explore 5XBK in 3D Show helices and sheets RCSB PDB PDBe
5XBK contains 105 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 696-706 | 11 | |
| α-helix | 711-734 | 24 | |
| α-helix | 738-760 | 23 | |
| α-helix | 765-782 | 18 | |
| α-helix | 783-786 | 4 | |
| α-helix | 792-804 | 13 | |
| α-helix | 828-846 | 19 | |
| α-helix | 852-864 | 13 | |
| β-strand | 868 | 1 | 2 |
| β-strand | 870 | 1 | 2 |
| α-helix | 872-889 | 18 | |
| α-helix | 890-896 | 7 | |
| α-helix | 897-907 | 11 | |
| α-helix | 914-929 | 16 | |
| α-helix | 933-936 | 4 | |
| α-helix | 939-949 | 11 | |
| α-helix | 955-969 | 15 | |
| α-helix | 981-987 | 7 | |
| α-helix | 989 | 1 | |
| α-helix | 991 | 1 | |
| α-helix | 995-997 | 3 | |
| α-helix | 998-1010 | 13 | |
| α-helix | 1013-1015 | 3 | |
| α-helix | 1020-1030 | 11 | |
| α-helix | 1038-1053 | 16 | |
| α-helix | 1056-1065 | 10 | |
| α-helix | 1070-1077 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 695-702 | 8 | |
| α-helix | 703-707 | 5 | |
| α-helix | 711-732 | 22 | |
| α-helix | 739-761 | 23 | |
| α-helix | 765-781 | 17 | |
| α-helix | 784-787 | 4 | |
| α-helix | 792-804 | 13 | |
| α-helix | 828-836 | 9 | |
| α-helix | 839-846 | 8 | |
| α-helix | 852-863 | 12 | |
| α-helix | 864-866 | 3 | |
| α-helix | 872-889 | 18 | |
| α-helix | 890-896 | 7 | |
| α-helix | 897-907 | 11 | |
| α-helix | 913-929 | 17 | |
| α-helix | 931-935 | 5 | |
| α-helix | 938-949 | 12 | |
| α-helix | 955-971 | 17 | |
| α-helix | 976-978 | 3 | |
| α-helix | 979-988 | 10 | |
| α-helix | 989 | 1 | |
| α-helix | 991 | 1 | |
| α-helix | 998-1011 | 14 | |
| α-helix | 1017-1019 | 3 | |
| α-helix | 1020-1030 | 11 | |
| α-helix | 1038-1053 | 16 | |
| α-helix | 1056-1063 | 8 | |
| α-helix | 1070-1072 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 696-703 | 8 | |
| α-helix | 704-706 | 3 | |
| α-helix | 711-732 | 22 | |
| α-helix | 738-760 | 23 | |
| α-helix | 765-781 | 17 | |
| α-helix | 783-786 | 4 | |
| α-helix | 793-805 | 13 | |
| α-helix | 826-836 | 11 | |
| α-helix | 839-846 | 8 | |
| α-helix | 852-864 | 13 | |
| α-helix | 872-889 | 18 | |
| α-helix | 890-894 | 5 | |
| α-helix | 897-907 | 11 | |
| α-helix | 913-929 | 17 | |
| α-helix | 938-945 | 8 | |
| α-helix | 948-951 | 4 | |
| α-helix | 955-971 | 17 | |
| α-helix | 979-987 | 9 | |
| α-helix | 995-997 | 3 | |
| α-helix | 998-1011 | 14 | |
| α-helix | 1013-1015 | 3 | |
| α-helix | 1017-1019 | 3 | |
| α-helix | 1020-1029 | 10 | |
| α-helix | 1038-1051 | 14 | |
| α-helix | 1056-1062 | 7 | |
| α-helix | 1069-1075 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 696-704 | 9 | |
| α-helix | 705-707 | 3 | |
| α-helix | 711-729 | 19 | |
| α-helix | 731-734 | 4 | |
| α-helix | 741-761 | 21 | |
| α-helix | 765-781 | 17 | |
| α-helix | 792-804 | 13 | |
| α-helix | 827-846 | 20 | |
| α-helix | 852-864 | 13 | |
| β-strand | 868 | 1 | 1 |
| β-strand | 870 | 1 | 1 |
| α-helix | 872-889 | 18 | |
| α-helix | 890-896 | 7 | |
| α-helix | 897-907 | 11 | |
| α-helix | 913-928 | 16 | |
| α-helix | 935-937 | 3 | |
| α-helix | 938-951 | 14 | |
| α-helix | 955-971 | 17 | |
| α-helix | 979-987 | 9 | |
| α-helix | 989 | 1 | |
| α-helix | 991 | 1 | |
| α-helix | 995-997 | 3 | |
| α-helix | 998-1010 | 13 | |
| α-helix | 1013-1017 | 5 | |
| α-helix | 1020-1030 | 11 | |
| α-helix | 1038-1052 | 15 | |
| α-helix | 1056-1062 | 7 | |
| α-helix | 1074-1076 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Importin-4 | A, B, C, D | protein | 416 | Homo sapiens | Q8TEX9 (AlphaFold model) |
| histone H3 | E | protein | 18 | Xenopus laevis | P84233 (AlphaFold model) |
>5XBK_1 Importin-4 (chains A, B, C, D) GSAFFDEKEDTCAAVGEISVNTSVAFLPYMESVFEEVFKLLECPHLNVRKAAHEALGQFC CALHKACQSCPSEPNTAALQAALARVVPSYMQAVNRERERQVVMAVLEALTGVLRSCGTL TLKPPGRLAELCGVLKAVLQRKTACQDTDEEEEEEDDDQAEYDAMLLEHAGEAIPALAAA AGGDSFAPFFAGFLPLLVCKTKQGCTVAEKSFAVGTLAETIQGLGAASAQFVSRLLPVLL STAQEADPEVRSNAIFGMGVLAEHGGHPAQEHFPKLLGLLFPLLARERHDRVRDNICGAL ARLLMASPTRKPEPQVLAALLHALPLKEDLEEWVTIGRLFSFLYQSSPDQVIDVAPELLR ICSLILADNKIPPDTKAALLLLLTFLAKQHTDSFQAALGSLPVDKAQELQAVLGLS
>5XBK_2 histone H3 (chains E) ARTKQTARKSTGGKAPRK
Integrative Structural Investigation on the Architecture of Human Importin4_Histone H3/H4_Asf1a Complex and Its Histone H3 Tail Binding. Yoon, J., Kim, S.J., An, S. et al. J Mol Biol (2018) 430:822-841. DOI 10.1016/j.jmb.2018.01.015 · PubMed
Other PDB entries of the same protein (UniProt Q8TEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5XBK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.