5XME: C-terminal domain of TRADD

Solution structure of C-terminal domain of TRADD. Determined by solution NMR. Released 6 Sept 2017.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 911
Mol. weight: 14.43 kDa
Released: 6 Sept 2017

Explore 5XME in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XME contains 8 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	201-204	4	1
β-strand	207-210	4	1
α-helix	216-226	11
α-helix	227-229	3
α-helix	230-240	11
α-helix	242-244	3
α-helix	248-255	8
α-helix	261-275	15
α-helix	282-292	11
α-helix	295-301	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor type 1-associated DEATH domain protein	A	protein	127	Homo sapiens	Q15628 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XME_1 Tumor necrosis factor receptor type 1-associated DEATH domain protein (chains A)
MHHHHHHSSGRGSAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALR
DPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLT
DPNGGLA

Primary citation

Structure of the C-terminal domain of TRADD reveals a novel fold in the death domain superfamily. Zhang, N., Yuan, W., Fan, J.S. et al. Sci Rep (2017) 7:7073-7073. DOI 10.1038/s41598-017-07348-9 · PubMed

Other PDB entries of the same protein (UniProt Q15628 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AC0 1.45 Å, Crystal structure of TRADD death domain GlcNAcylated by EPEC effector NleB
1F3V 2.0 Å, Crystal structure of the complex between the N-terminal domain of TRADD and the TRAF…
9VGD 3.3 Å, Helical assembly of TRADD death domain
9VIN 3.41 Å, Ternary complex of TNFR1-DD, TRADD-DD and RIPK1-DD
1F2H Solution structure of the N-terminal domain of the TNFR1 associated protein, tradd.
7CSQ Solution structure of the complex between p75NTR-DD and TRADD-DD

Browse structure collections

About this viewer

MolViewer shows 5XME directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.