5XOG: RNA Polymerase II elongation complex

RNA Polymerase II elongation complex bound with Spt5 KOW5 and Elf1. Determined by X-ray diffraction at 3.0 Å resolution. Released 16 Aug 2017.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Komagataella phaffii (strain GS115 / ATCC 20864), Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1), synthetic construct
Chains: 17
Atoms: 33,711
Mol. weight: 556.72 kDa
Ligands: APC, MG, ZN
Released: 16 Aug 2017

Explore 5XOG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XOG contains 213 α-helices and 252 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 85 helices, 75 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
α-helix	10	1
β-strand	11	1	1
β-strand	16-18	3	2
β-strand	21	1	3
α-helix	22-23	2
α-helix	24-30	7
β-strand	34	1	4
β-strand	37	1	5
β-strand	41	1	6
β-strand	48	1	6
α-helix	49	1
β-strand	52	1	5
α-helix	56-58	3
β-strand	82-91	10	4
α-helix	96-105	10
β-strand	106	1	7
β-strand	113	1	7
α-helix	120-125	6
α-helix	131-142	12
β-strand	147	1	8
β-strand	151	1	9
β-strand	164	1	9
α-helix	170	1
β-strand	171	1	8
α-helix	172-173	2
β-strand	174-178	5	10
β-strand	181-186	6	10
β-strand	199-202	4	10
α-helix	205-213	9
α-helix	217-222	6
β-strand	226	1	11
β-strand	230	1	11
α-helix	232-235	4
β-strand	236-242	7	4
α-helix	245-247	3
β-strand	251-252	2	12
β-strand	258-259	2	12
α-helix	262-278	17
α-helix	290-305	16
α-helix	313-315	3
β-strand	316	1	13
β-strand	322	1	13
α-helix	323	1
α-helix	326-330	5
α-helix	336-340	5
β-strand	344-346	3	14
β-strand	349-356	8	15
β-strand	364-368	5	15
α-helix	369-374	6
β-strand	376-380	5	16
α-helix	381	1
α-helix	386-395	10
β-strand	403-407	5	16
β-strand	413-415	3	16
α-helix	422-424	3
α-helix	427-428	2
β-strand	432-436	5	16
α-helix	437	1
β-strand	442-446	5	15
α-helix	453-455	3
β-strand	456-464	9	15
β-strand	469-471	3	15
α-helix	473-475	3
α-helix	476-479	4
β-strand	487-491	5	15
α-helix	496-501	6
α-helix	502-506	5
β-strand	507	1	15
α-helix	508-511	4
β-strand	513-514	2	17
β-strand	519-520	2	17
α-helix	526-535	10
β-strand	541-543	3	18
α-helix	544-552	9
α-helix	561-564	4
β-strand	566-568	3	18
β-strand	572-574	3	18
α-helix	575-582	8
α-helix	584	1
β-strand	589-591	3	19
β-strand	606-609	4	19
β-strand	612-615	4	19
α-helix	620-623	4
α-helix	630-638	9
α-helix	640-661	22
β-strand	664	1	20
α-helix	667-670	4
α-helix	674-699	26
α-helix	703-706	4
α-helix	711-737	27
α-helix	743-750	8
α-helix	756-759	4
α-helix	760-764	5
β-strand	767-768	2	21
β-strand	770-771	2	22
β-strand	774-775	2	22
α-helix	776-777	2
β-strand	780	1	23
β-strand	783	1	23
β-strand	800-801	2	21
α-helix	811-846	36
β-strand	850-851	2	24
β-strand	857-858	2	24
β-strand	864-866	3	24
α-helix	869-871	3
β-strand	874	1	25
α-helix	876-878	3
β-strand	879-883	5	26
α-helix	891-898	8
α-helix	905-907	3
α-helix	911-913	3
β-strand	914	1	27
α-helix	924-943	20
α-helix	944-948	5
β-strand	955-959	5	26
α-helix	962-972	11
β-strand	981	1	27
α-helix	985-995	11
α-helix	1007-1016	10
α-helix	1018-1027	10
α-helix	1030-1031	2
α-helix	1032-1037	6
α-helix	1041-1056	16
β-strand	1059	1	25
α-helix	1060-1061	2
α-helix	1066-1078	13
α-helix	1099-1107	9
β-strand	1118-1120	3	28
β-strand	1122	1	29
α-helix	1124-1127	4
α-helix	1130-1140	11
β-strand	1143-1144	2	30
α-helix	1145-1148	4
β-strand	1149-1156	8	31
α-helix	1169-1175	7
β-strand	1193-1199	7	31
α-helix	1201-1206	6
α-helix	1211-1222	12
β-strand	1226-1230	5	31
β-strand	1238-1244	7	31
α-helix	1260-1273	14
β-strand	1275-1277	3	30
β-strand	1284-1295	12	28
β-strand	1301-1312	12	28
α-helix	1316-1321	6
β-strand	1325	1	29
β-strand	1331-1332	2	28
α-helix	1335-1342	8
α-helix	1344-1361	18
α-helix	1368-1379	12
α-helix	1389-1392	4
α-helix	1399-1403	5
α-helix	1408-1417	10
β-strand	1421-1422	2	2
α-helix	1427-1432	6
α-helix	1440-1442	3
β-strand	1444-1448	5	32
α-helix	1450-1453	4
α-helix	1458-1460	3

Chain B: 57 helices, 85 β-strands

Element	Residues	Length	Sheet
α-helix	14-28	15
α-helix	32-40	9
α-helix	41-45	5
α-helix	46-50	5
β-strand	55-57	3	33
β-strand	72	1	34
β-strand	75-84	10	33
β-strand	88-90	3	35
β-strand	96-98	3	35
α-helix	101-106	6
β-strand	112-123	12	33
β-strand	126	1	34
β-strand	156-162	7	33
α-helix	163-164	2
α-helix	176-182	7
β-strand	194-196	3	36
β-strand	199-203	5	36
α-helix	204	1
β-strand	205-209	5	37
α-helix	210	1
β-strand	215-218	4	38
β-strand	225-234	10	38
β-strand	241-250	10	38
β-strand	261-263	3	38
β-strand	272-273	2	38
α-helix	274-279	6
α-helix	286-293	8
α-helix	300-305	6
α-helix	307-311	5
α-helix	319-327	9
α-helix	337-350	14
α-helix	364-382	19
α-helix	387-389	3
α-helix	394-396	3
β-strand	397-400	4	37
α-helix	402-428	27
α-helix	444-456	13
β-strand	459	1	39
α-helix	462-464	3
β-strand	469	1	39
α-helix	470	1
β-strand	473-475	3	36
α-helix	476-477	2
α-helix	481-488	8
β-strand	490-492	3	37
α-helix	503-505	3
α-helix	509-511	3
β-strand	515	1	40
β-strand	526	1	37
β-strand	529-531	3	37
β-strand	532	1	40
β-strand	533	1	41
β-strand	537-538	2	42
α-helix	545-553	9
β-strand	557	1	43
α-helix	570	1
β-strand	571-575	5	43
β-strand	578-583	6	43
α-helix	586-599	14
β-strand	607-611	5	43
β-strand	616-620	5	43
β-strand	626-632	7	42
β-strand	633	1	44
α-helix	634	1
β-strand	645	1	44
α-helix	649-657	9
α-helix	678-682	5
β-strand	687-691	5	42
α-helix	692-695	4
β-strand	700-701	2	42
α-helix	704-707	4
α-helix	725-728	4
β-strand	740-741	2	42
α-helix	745-748	4
β-strand	750	1	41
α-helix	753-755	3
α-helix	759-761	3
β-strand	762	1	45
α-helix	764-773	10
α-helix	774-776	3
β-strand	777	1	46
β-strand	779	1	47
β-strand	792-796	5	47
β-strand	800	1	48
β-strand	804-805	2	49
α-helix	809-812	4
β-strand	821-827	7	50
β-strand	828	1	20
β-strand	838-842	5	50
α-helix	843-847	5
β-strand	853-862	10	47
β-strand	865	1	51
β-strand	871	1	51
β-strand	873-874	2	52
β-strand	882-883	2	52
β-strand	893	1	53
β-strand	898	1	54
β-strand	899	1	53
α-helix	900	1
β-strand	904-906	3	47
β-strand	910-912	3	54
β-strand	914-917	4	52
α-helix	918-919	2
β-strand	934-936	3	52
β-strand	939-940	2	54
α-helix	941-942	2
β-strand	946-956	11	47
β-strand	962-972	11	47
β-strand	979-982	4	50
β-strand	987-994	8	50
α-helix	996-998	3
β-strand	1001-1002	2	55
β-strand	1010-1012	3	50
α-helix	1014-1016	3
β-strand	1022	1	45
α-helix	1023-1038	16
β-strand	1042-1043	2	49
α-helix	1052-1060	9
β-strand	1069-1070	2	50
β-strand	1072-1073	2	55
α-helix	1079	1
β-strand	1080	1	55
α-helix	1081	1
β-strand	1085-1094	10	50
β-strand	1095	1	46
α-helix	1099-1101	3
β-strand	1104-1106	3	15
β-strand	1111	1	56
β-strand	1118	1	56
α-helix	1119	1
α-helix	1122-1124	3
β-strand	1128-1130	3	14
α-helix	1132-1141	10
α-helix	1144-1151	8
β-strand	1157-1163	7	1
β-strand	1171-1174	4	57
β-strand	1179-1182	4	57
β-strand	1187	1	57
β-strand	1191-1197	7	1
α-helix	1198-1208	11
β-strand	1212	1	3
β-strand	1215-1217	3	2

Chain C: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	58
β-strand	16-22	7	58
α-helix	26-38	13
β-strand	42-53	12	59
α-helix	59-67	9
β-strand	71	1	60
α-helix	76-78	3
α-helix	80-81	2
α-helix	82-84	3
β-strand	95-103	9	59
β-strand	111-114	4	61
α-helix	115-117	3
β-strand	119-122	4	59
α-helix	131	1
β-strand	132	1	60
α-helix	133	1
β-strand	143-147	5	61
β-strand	152-162	11	59
α-helix	168-170	3
β-strand	173-180	8	58
α-helix	197-200	4
α-helix	202-204	3
α-helix	207-209	3
α-helix	211-214	4
β-strand	227-234	8	58
α-helix	240-265	26

Chain D: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	32
β-strand	24	1	62
β-strand	29	1	62
β-strand	37-39	3	63
β-strand	45-47	3	63
β-strand	50-51	2	32
α-helix	53-71	19
α-helix	86-89	4
α-helix	90-92	3
α-helix	96-110	15
α-helix	118-128	11
α-helix	139-147	9
α-helix	153-159	7
α-helix	161-166	6
α-helix	171-181	11

Chain E: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	3-24	22
β-strand	27	1	64
α-helix	31-34	4
α-helix	38-45	8
β-strand	46	1	65
β-strand	52	1	65
α-helix	54-56	3
β-strand	59-61	3	66
β-strand	63	1	64
α-helix	65-70	6
β-strand	77-81	5	66
β-strand	86-87	2	67
α-helix	89-101	13
β-strand	106-111	6	66
β-strand	114-115	2	67
α-helix	117-120	4
β-strand	130-135	6	66
α-helix	136-139	4
α-helix	143-145	3
α-helix	150-151	2
β-strand	152-154	3	68
α-helix	155-156	2
α-helix	157-166	10
α-helix	171-173	3
β-strand	176-177	2	68
α-helix	182-187	6
β-strand	194-201	8	68
β-strand	205-213	9	68

Chain F: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	73	1	32
α-helix	74-75	2
α-helix	76-78	3
β-strand	84	1	69
α-helix	85-86	2
α-helix	87-102	16
α-helix	105-107	3
α-helix	117-126	10
β-strand	132-137	6	32
β-strand	143-147	5	32
β-strand	152	1	69

Chain G: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	32
α-helix	15-17	3
α-helix	22-34	13
β-strand	38-39	2	32
β-strand	43-48	6	32
α-helix	51-53	3
α-helix	58-59	2
β-strand	60-61	2	32
α-helix	62	1
β-strand	68-79	12	32
β-strand	86-95	10	70
β-strand	98-103	6	70
β-strand	106-111	6	70
α-helix	112-114	3
β-strand	120-122	3	71
β-strand	129-131	3	71
β-strand	136-138	3	71
β-strand	142-152	11	70
β-strand	157-162	6	70
β-strand	169-170	2	70

Chain H: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6-16	11	18
β-strand	23-30	8	18
β-strand	37-43	7	18
β-strand	54-60	7	18
α-helix	80-82	3
α-helix	88-91	4
β-strand	94-105	12	18
β-strand	111-117	7	18
β-strand	120-126	7	18
α-helix	128-131	4
α-helix	132-134	3
β-strand	138-144	7	18

6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit	A	protein	1743	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R4Y0
DNA-directed RNA polymerase subunit beta	B	protein	1227	Komagataella phaffii (strain GS115 / ATCC 20864)	C4QZQ7 (AlphaFold model)
RNA polymerase II third largest subunit B44, part of central core	C	protein	304	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R7L2 (AlphaFold model)
RNA polymerase II subunit B32	D	protein	186	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R2U9 (AlphaFold model)
RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III	E	protein	214	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R3P8
RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III	F	protein	155	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R1V1
RNA polymerase II subunit	G	protein	171	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R9A1
RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III	H	protein	145	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R273
DNA-directed RNA polymerase subunit	I	protein	115	Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1)	F2QPE6
RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III	J	protein	72	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R009
RNA polymerase II subunit B12.5	K	protein	118	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R3Z5
RNA polymerase subunit ABC10-alpha	L	protein	72	Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1)	F2QMI1

5 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>5XOG_1 DNA-directed RNA polymerase subunit (chains A)
MSQFPYSSAPLRSVKEVQFGLLSPEEIRAISVVKIEYPEIMDESRQRPREGGLNDPKLGS
IDRNFKCQTCGEGMAECPGHFGHMELAKPVFHIGFIPKIKKVCECICMNCGKLLLDETNP
TMAQAIRIRDPKKRFNAVWQLCKTKMVCEADAPVDEYSEQKVVSRGGCGNTQPVVRKDGM
KLWGTWKKSGFSDRDAQPERKLLTPGEILNVFKHISPEDCFRLGFNEDYARPEWMIITVL
PVPPPQVRPSIAMDETTQGQDDLTHKLSDILKANINVQKLEMDGSPQHIINEVEQLLQFH
VATYMDNDIAGQPQALQKSGRPVKAIRARLKGKEGRLRGNLMGKRVDFSARTVISGDPNL
ELDQVGVPISIAKTLSYPETVTQYNIHRLTEYVRNGPNEHPGAKYVIRDNGDRIDLRYHK
RAGDIVLQYGWKVERHLMDDDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYN
ADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPVMGIVQDTLCGVRKMTLRDT
FIEYEQVMNMLFWVPSWDGVVPQPAILKPKPLWTGKQLLSIAIPSGIHLQRTDGGNSLLS
PKDNGMLIVDGKVMFGVVDKKTVGSGGGGLIHTVMREKGPKICAELFGNIQKVVNYWLLH
NGFSIGIGDAIADASTMKEITHAISSAKEQVQEIIYKAQHNELELKPGMTLRESFEGEVS
RTLNDARDSAGRSAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQMVEGKRIAFGF
ADRSLPHFTKDDFSPESKGFVENSYLRGLTPQEFFFHAMAGREGLIDTAVKTAETGYIQR
RLVKALEDIMVHYDGTTRNSLGDIIQFLYGEDGLDGTQVERQTIDTIPGSDKAFHKRYYV
DLMDEKNSIKPDVIEYAADILGDVELQKELNSEYEQLVSDRKFLREIVFVNGDHNWPLPV
NLRRIIQNAQQIFHLDRAKASDLTIPEIIHGVRDLCKKLFVLRGENELIKEAQQNATSLF
QCLVRARLATRRILEEFRLNRDAFEWVLGTIEAQFQRSLVHPGEMVGVIAAQSIGEPATQ
MTLNTFHYAGVSSKNVTLGVPRLKEILNVAKNIKTPALTVYLDREIALDIEKAKVIQSSI
EYTTLKNVTSATEIYYDPDPTSTVIEEDFDTVEAYFSIPDEKVEETIDKQSPWLLRLELD
RARMLDKQLTMNQVADKISEVFSDDLFVMWSEDNADKLIIRCRVIRDPKAMDEELEAEED
QMLKRIEAHMLDLIALRGIPGISKVYMVKHKVSVPDESGEYKNEELWALETDGINLAEVM
AVPGVDSSRTYSNSFVEILSVLGIEATRSSLYKEILNVIAFDGSYVNYRHMALLVDVMTS
RGYLMAITRHGINRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVMLGQLAPMG
TGAFDVMIDEKLLTSLPADYAPTMPLFKGKATQGSATPYDNNAQYDDEFNHDDVADVMFS
PMAETGSGDDRSGGLTEYAGIQSPYQPTSPGLSATSPGFAPTSPGFAPTSPRYSPTSPGY
SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
PSYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYS
PTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPASPQYSPSRHSPNGESK
EGE

Sequence of entity 2 (B), FASTA

>5XOG_2 DNA-directed RNA polymerase subunit beta (chains B)
MSYDPYSIDDTITTEDCWTVISAFFEEKGLVSQQLDSFDEFMETSIQDLVWEEPRLILDQ
PAQHTNEKDNINKRYEIRFGKIYLSRPTMTEADGTTHAMFPQEARLRNLTYSSPVYLDME
KSMFTSIDDEGNPNATLDWQQVHEPIKDGVEEGNKVHIGKVPIMLRSKFCSLRTLDEVDL
YKMKECPYDMGGYFVINGSEKVLIAQERSAANIVQVFKKAAPSPISHVAEIRSALEKGSR
LISTMQIKLYGREDKGTGRTIKATLPYVKQDIPIVIVFRALGVVPDGEILQHICYDENDW
QMLEMLKPCIEEGFVIQDKEVALDFIGRRGSAALGIRREKRIQYAKDILQKELLPHITQE
EGFETRKTFFLGYMVNRLLLCALERKDQDDRDHFGKKRLDLAGPLLANLFRILFRKLTRE
IYRYMQRCIETDRDFNLNLAVKSTTITSGLKYSLATGNWGEQKKAMSSRAGVSQVLNRYT
YSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLLSGISI
GSPSEPIINFLEEWGMEPLEDYDPAQHTKSTRIFVNGVWTGIHRDPSMLVSTMRDLRRSG
AISPEVSIIRDIREREFKIFTDVGRVYRPLFIVEDDESKDNKGELRITKEHIRKIQQGYD
DDAMNDDSEEQEQDVYGWSSLVTSGVIEYVDGEEEETIMIAMTPEDLQTRSLEQKEIDLN
DTAKRIKPEMSTSSHHTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGV
FLTNYNVRMDTMANILYYPQKPLAKTQAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMI
MNQSSIDRGLFRSLFFRSYMDQEKRFGISIVEEFEKPTRATTLRLKHGTYEKLDEDGLIA
PGVRVSGDDIIIGKTTPIPPDTEELGQRTKYHTKRDASTPLRSTENGIVDQVLLTTNQEG
LKFVKVRMRTTKVPQIGDKFASRHGQKGTIGVTYRHEDMPFSAEGIVPDLIINPHAIPSR
MTVAHLIECLLSKVGSIRGYEGDATPFTDLTVDAVSNLLRDNGYQSRGFEVMYNGHTGKK
LMAQVFFGPTYYQRLRHMVDDKIHARARGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIA
HGAAGFLKERLMEASDAFRVHVCGICGLMSVIANLKKNQFECRSCKNKTNIYQLHIPYAA
KLLFQELMAMNIAPRLYTERSGVSMRS

Sequence of entity 3 (C), FASTA

>5XOG_3 RNA polymerase II third largest subunit B44, part of central core (chains C)
MSKEPKVNIINAQDDEVELMLSDVNLSLANSLRRTMLAEVPTLAIDLVEIKMNTSVLADE
FISHRLGLIPLVSEDVEEMKYSRDCTCEDYCDECSVVLELSARHEGEEGTTDVYSSSLIK
VSGPGNLNVGEPVRRDDYDQGILLCKLRNHQELNIRCIAKKGIAKEHAKWSPCSAIAFEY
DPHNKLKHTDFWFEVDAKKEWPDSKYATWEEPPKPGEVFDYKAKPNRFYMTVETTGSLKA
NQVFSRGIKTLQEKLANVLFELENSRPANTTAYGGATAYGGQTVYGRETSYGGNTNYGDY
NAPY

Sequence of entity 4 (D), FASTA

>5XOG_4 RNA polymerase II subunit B32 (chains D)
MNVSTSTVGARRRRAKQQVDDEENATLLRLGPEFALKQYDHDGNEHDLIALSLSESRLLI
REALKARSRARNGGVDIESSNGEIDDDELAKVTSGAVANGVVKKTLDYLNTFARFKDEET
CTAVDQLLHNSSDCSVLHPFEIAQLSSLGCEDVDEAITLIPSLAAKKEVNLQRILDELNR
LEDPYK

Sequence of entity 5 (E), FASTA

>5XOG_5 RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III (chains E)
MEDNNRIISRLWRSFRTVKEMAADRGYFISQEEMDQSLEEFRSKICDSMGNPQRKLMSFL
ANPTPEALEKYSDLGTLWVEFCDEPSVGIKTMRNFCLRIQEKNFSTGIFIYQNNITPSAN
KMIPTVSPAIIETFQESDLVVNITHHELVPKHIRLSDGEKSQLLQRYKLKESQLPRIQRE
DPVARYLGLKRGQVVKIIRRSETSGRYASYRICL

Sequence of entity 6 (F), FASTA

>5XOG_6 RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III (chains F)
MSEDEAFNEQTENFENFEDEHFSDDNFEDRSTQPEDYAVGVTADGRQIINGDGIQEVNGT
IKAHRKRSNKELAILKEERTTTPYLTKYERARILGTRALQISMNAPVLVDIEGETDPLQI
AMKELSQRKIPLVIRRYLPDGSYEDWGCDELIVDN

Sequence of entity 7 (G), FASTA

>5XOG_7 RNA polymerase II subunit (chains G)
MFFLKDLSLILTLHPSYFGPQMNQYLREKLLTDVEGTCTGQFGYIVTVLDGMNIDVGKGR
IIPGSGSAEFEVKYRAVVWKPFKGEVVDAIVSNVSPIGFFADVGPLNVFVSTRLIPDNLV
YNPSNSPPAYMSNDELITKGSKVRLKVVGTRTDVNEIYAIGSIKEDFLGAI

Sequence of entity 8 (H), FASTA

>5XOG_8 RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III (chains H)
MSSALFDDIFTVQTVDNGRYNKVSRIIGISTTNSAIKLTLDINNEMFPVSQDDSLTVTLA
NSLSLDGEDESANFSKSWRPPKPTDKSLADDYDYVMFGTVYKFEEGDEDKIKVYVSFGGL
LMCLEGGYKSLASLKQDNLYILIRR

Sequence of entity 9 (I), FASTA

>5XOG_9 DNA-directed RNA polymerase subunit (chains I)
MASFRFCLECNNMLYPKEDKENQRLLYSCRNCDYTELAEDPKVYRHELITNIGETAGIVD
DIGQDPTLPRSDKECPECHSRDCVFFQSQQRRKDTNMTLFYVCLNCKKTFRDESE

Sequence of entity 10 (J), FASTA

>5XOG_10 RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III (chains J)
MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVLTHVDLIEKFL
RYNPLEKKDFDS

Sequence of entity 11 (K), FASTA

>5XOG_11 RNA polymerase II subunit B12.5 (chains K)
MNAPDRFELFILPDDVPKLKITPDSRVPNCIIIKFEREDHTLANLLREELALYPDVTFVA
YKVEHPLFANFVMRLQTEEGTRPKQALERACASIINKLKTLDHKFNEEWNIKNFSLND

Sequence of entity 12 (L), FASTA

>5XOG_12 RNA polymerase subunit ABC10-alpha (chains L)
MSREGFVAPSGTDLAAAASGVAPNKHYGVKYTCGACAHNFSLNKSDPVRCKECGHRVIYK
ARTKRMIQFDAR

Ligands and cofactors

ID	Name	Formula	Copies
APC	Diphosphomethylphosphonic acid adenosyl ester	C11 H18 N5 O12 P3	1
MG	Magnesium ion	Mg	1
ZN	Zinc ion	Zn	9

Primary citation

Structure of the complete elongation complex of RNA polymerase II with basal factors. Ehara, H., Yokoyama, T., Shigematsu, H. et al. Science (2017) 357:921-924. DOI 10.1126/science.aan8552 · PubMed

Other PDB entries of the same protein (UniProt C4R4Y0), best resolution first:

7XN7 3.1 Å, RNA polymerase II elongation complex containing Spt4/5, Elf1, Spt6, Spn1 and Paf1C
8JH4 3.2 Å, RNA polymerase II elongation complex containing 60 bp upstream DNA loop, stalled at…
8YFQ 3.3 Å, Cryo EM structure of Komagataella phaffii RNAPII-Rat1-Rai1 pre-termination complex
7XSZ 3.4 Å, RNA polymerase II elongation complex transcribing a nucleosome (EC115)
8YFR 3.4 Å, Cryo EM structure of Komagataella phaffii Rat1-Rai1 complex bound within the RNAPII cleft
9WMS 3.4 Å, Co-transcriptional histone H3K36 methylation complex containing RNA polymerase II…
9II7 3.5 Å, RNA polymerase II elongation complex stalled at SHL(-1) of the nucleosome containing…
9WMT 3.59 Å, Co-transcriptional histone H3K36 methylation complex containing RNA polymerase II…
7XSE 3.6 Å, RNA polymerase II elongation complex transcribing a nucleosome (EC42)
9UJS 3.62 Å, RNA polymerase II elongation complex stalled at SHL(-4) of the H3-H4 octasome
9WMW 3.62 Å, Co-transcriptional histone H3K36 methylation complex containing RNA polymerase II…
8JH3 3.7 Å, RNA polymerase II elongation complex containing 40 bp upstream DNA loop, stalled at…

Browse structure collections

About this viewer

MolViewer shows 5XOG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.