5XTZ: GAS41 YEATS

Crystal structure of GAS41 YEATS bound to H3K27ac peptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 27 Jun 2018.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 5
Atoms: 4,862
Mol. weight: 76.36 kDa
Released: 27 Jun 2018

Explore 5XTZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XTZ contains 16 α-helices and 36 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	20-33	14	1
β-strand	45-53	9	1
β-strand	63-69	7	2
β-strand	78-81	4	2
β-strand	86-92	7	1
β-strand	95-96	2	3
β-strand	97-104	8	2
α-helix	110-111	2
β-strand	112-117	6	2
α-helix	122-123	2
α-helix	124-128	5
β-strand	134-145	12	1
α-helix	149-155	7

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	20-33	14	4
β-strand	45-53	9	4
α-helix	59-61	3
β-strand	63-69	7	5
β-strand	78-81	4	5
β-strand	86-92	7	4
β-strand	97-104	8	5
α-helix	110-111	2
β-strand	112-117	6	5
β-strand	134-145	12	4
α-helix	149-155	7

Chain C: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	20-33	14	6
β-strand	45-53	9	6
β-strand	63-69	7	7
β-strand	78-81	4	7
β-strand	86-92	7	6
β-strand	97-104	8	7
α-helix	110-111	2
β-strand	112-117	6	7
α-helix	122-123	2
α-helix	124-128	5
β-strand	134-145	12	6
α-helix	149-154	6

Chain D: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	8
β-strand	20-33	14	9
β-strand	45-53	9	9
α-helix	59-61	3
β-strand	63-69	7	10
β-strand	78-81	4	10
β-strand	86-92	7	9
β-strand	97-104	8	10
α-helix	110-111	2
β-strand	112-117	6	10
α-helix	122-123	2
α-helix	124-128	5
β-strand	134-145	12	9
β-strand	148	1	8
α-helix	149-154	6

Chain E: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	27-28	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
YEATS domain-containing protein 4	A, B, C, D	protein	163	Homo sapiens	O95619 (AlphaFold model)
Thr-lys-ala-ala-arg-aly-ser-ala-pro-ala	E	protein	10	Homo sapiens	P68431 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5XTZ_1 YEATS domain-containing protein 4 (chains A, B, C, D)
GSHMASMTGGQQMGRGSGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRN
EDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYH
LLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSR

Sequence of entity 2 (E), FASTA

>5XTZ_2 THR-LYS-ALA-ALA-ARG-ALY-SER-ALA-PRO-ALA (chains E)
TKAARKSAPA

Primary citation

Gas41 links histone acetylation to H2A.Z deposition and maintenance of embryonic stem cell identity. Hsu, C.C., Zhao, D., Shi, J. et al. Cell Discov (2018) 4:28-28. DOI 10.1038/s41421-018-0027-0 · PubMed

Other PDB entries of the same protein (UniProt O95619 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IJ0 1.52 Å, Crystal structure of GAS41 YEATS domain in complex with H3K9ac peptide
7EIF 1.58 Å, Crystal structure of GAS41 YEATS domain
5R68 1.64 Å, XChem group deposition -- Crystal Structure of human YEATS4 in complex with FM000199e
9X8S 1.7 Å, Crystal structure of the human GAS41 YEATS domain in complex with an acetylated YFV…
5R69 1.83 Å, XChem group deposition -- Crystal Structure of human YEATS4 in complex with XS038644e
5VNA 2.1 Å, Crystal structure of human YEATS domain
8IIZ 2.1 Å, Crystal structure of MBP fused GAS41 YEATS domain in complex with H3K27ac peptide
7JFY 2.1 Å, GAS41 YEATS domain in complex with 5
8IIY 2.15 Å, Crystal structure of MBP fused GAS41 YEATS domain in complex with H3K14ac peptide
8I60 2.3 Å, Crystal structure of GAS41 YEATS domain in complex with histone H3K27cr
9O4Y 2.3 Å, GAS41 YEATS domain in complex with DLG-1
5VNB 2.4 Å, YEATS in complex with histone H3

Browse structure collections

About this viewer

MolViewer shows 5XTZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.