Crystal structure of Poz1 and Tpz1. Determined by X-ray diffraction at 2.5 Å resolution. Released 20 Dec 2017.
Explore 5XXE in 3D Show helices and sheets RCSB PDB PDBe
5XXE contains 29 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-18 | 17 | |
| α-helix | 31-42 | 12 | |
| α-helix | 45-47 | 3 | |
| α-helix | 51-53 | 3 | |
| α-helix | 54-64 | 11 | |
| α-helix | 93-115 | 23 | |
| α-helix | 129-158 | 30 | |
| α-helix | 164-174 | 11 | |
| α-helix | 179-188 | 10 | |
| α-helix | 193-206 | 14 | |
| α-helix | 209-229 | 21 | |
| α-helix | 238-245 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-18 | 18 | |
| α-helix | 28-30 | 3 | |
| α-helix | 31-43 | 13 | |
| α-helix | 45-47 | 3 | |
| α-helix | 51-53 | 3 | |
| α-helix | 54-64 | 11 | |
| α-helix | 93-115 | 23 | |
| α-helix | 130-158 | 29 | |
| α-helix | 164-174 | 11 | |
| α-helix | 179-188 | 10 | |
| α-helix | 193-206 | 14 | |
| α-helix | 209-231 | 23 | |
| α-helix | 238-245 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 480-484 | 5 | |
| α-helix | 490-507 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 480-483 | 4 | |
| α-helix | 490-507 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protection of telomeres protein poz1 | A, B | protein | 250 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | O13852 (AlphaFold model) |
| Protection of telomeres protein tpz1 | C, D | protein | 32 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | O14246 (AlphaFold model) |
>5XXE_1 Protection of telomeres protein poz1 (chains A, B) GSNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCHEKMPIFMDIA FIEYCFNLSLDPSSFQNLPITQTQPDSQQILWEYSLISNALERLENIELERQNCMREDGL VKYTNELLLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDWGSHNE KEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQLEVFCDYDFKQRE IVKMLTSNIN
>5XXE_2 Protection of telomeres protein tpz1 (chains C, D) EACEMCRLGLPHGSFFELLRDWKKIEEFRNKS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (SO4) are not listed.
Structure of the fission yeast S. pombe telomeric Tpz1-Poz1-Rap1 complex. Xue, J., Chen, H., Wu, J. et al. Cell Res (2017) 27:1503-1520. DOI 10.1038/cr.2017.145 · PubMed
Other PDB entries of the same protein (UniProt O13852 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5XXE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.