5XXF: Poz1, Tpz1 and Rap1

Crystal structure of Poz1, Tpz1 and Rap1. Determined by X-ray diffraction at 3.1 Å resolution. Released 20 Dec 2017.

Method: X-ray diffraction
Resolution: 3.1 Å
Organisms: Schizosaccharomyces pombe (strain 972 / ATCC 24843), Schizosaccharomyces pombe
Chains: 6
Atoms: 4,585
Mol. weight: 70.59 kDa
Ligands: ZN
Released: 20 Dec 2017

Explore 5XXF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XXF contains 29 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	2-18	17
α-helix	31-43	13
α-helix	45-47	3
α-helix	51-53	3
α-helix	54-64	11
α-helix	93-115	23
α-helix	130-157	28
α-helix	164-173	10
α-helix	179-189	11
α-helix	193-206	14
α-helix	209-229	21
α-helix	238-245	8

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	2-18	17
α-helix	31-43	13
α-helix	45-47	3
α-helix	51-53	3
α-helix	54-64	11
α-helix	93-115	23
α-helix	119-120	2
α-helix	130-158	29
α-helix	164-171	8
α-helix	179-190	12
α-helix	193-206	14
α-helix	209-231	23
α-helix	238-246	9

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	480-483	4
α-helix	490-505	16

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	480-484	5
α-helix	490-506	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protection of telomeres protein poz1	A, B	protein	248	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O13852 (AlphaFold model)
Protection of telomeres protein tpz1	C, D	protein	31	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O14246 (AlphaFold model)
Rap1	E, F	protein	17	Schizosaccharomyces pombe

Sequence of entity 1 (A, B), FASTA

>5XXF_1 Protection of telomeres protein poz1 (chains A, B)
GSNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCHEKMPIFMDIA
FIEYCFNLSLDPSSFQNLPITQTQPDSQQILWEYSLISNALERLENIELERQNCMREDGL
VKYTNELLLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDWGSHNE
KEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQLEVFCDYDFKQRE
IVKMLTSN

Sequence of entity 2 (C, D), FASTA

>5XXF_2 Protection of telomeres protein tpz1 (chains C, D)
ACEMCRLGLPHGSFFELLRDWKKIEEFRNKS

Sequence of entity 3 (E, F), FASTA

>5XXF_3 Rap1 (chains E, F)
NSDNIFVKPGEDLEIPL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structure of the fission yeast S. pombe telomeric Tpz1-Poz1-Rap1 complex. Xue, J., Chen, H., Wu, J. et al. Cell Res (2017) 27:1503-1520. DOI 10.1038/cr.2017.145 · PubMed

Other PDB entries of the same protein (UniProt O13852 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WE0 2.3 Å, Structural Basis for Shelterin Bridge Assembly
5WE2 2.5 Å, Structural Basis for Telomere Length Regulation by the Shelterin Bridge
5XXE 2.5 Å, Crystal structure of Poz1 and Tpz1
5WE1 3.2 Å, Structural Basis for Shelterin Bridge Assembly

Browse structure collections

About this viewer

MolViewer shows 5XXF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.