Zika virus helicase in complex with ADP-AlF3. Determined by X-ray diffraction at 2.0 Å resolution. Released 4 Jul 2018.
Explore 5Y6M in 3D Show helices and sheets RCSB PDB PDBe
5Y6M contains 26 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 189-192 | 4 | 1 |
| α-helix | 194-195 | 2 | |
| α-helix | 200-204 | 5 | |
| α-helix | 205-215 | 11 | |
| β-strand | 219-223 | 5 | 1 |
| α-helix | 226-235 | 10 | |
| β-strand | 241-243 | 3 | 1 |
| β-strand | 258-262 | 5 | 1 |
| α-helix | 263-271 | 9 | |
| α-helix | 275-277 | 3 | |
| β-strand | 281-285 | 5 | 1 |
| α-helix | 292-306 | 15 | |
| β-strand | 311-315 | 5 | 1 |
| β-strand | 333-337 | 5 | 2 |
| α-helix | 339-341 | 3 | |
| α-helix | 350-353 | 4 | |
| β-strand | 359-362 | 4 | 2 |
| α-helix | 366-378 | 13 | |
| β-strand | 383-386 | 4 | 2 |
| α-helix | 388-394 | 7 | |
| α-helix | 395-398 | 4 | |
| β-strand | 405-408 | 4 | 2 |
| α-helix | 410-413 | 4 | |
| β-strand | 422-425 | 4 | 2 |
| β-strand | 428-435 | 8 | 3 |
| β-strand | 439-447 | 9 | 3 |
| α-helix | 448-449 | 2 | |
| α-helix | 450-457 | 8 | |
| β-strand | 469-473 | 5 | 2 |
| α-helix | 485-494 | 10 | |
| α-helix | 505-508 | 4 | |
| α-helix | 509-514 | 6 | |
| α-helix | 523-525 | 3 | |
| α-helix | 526-536 | 11 | |
| α-helix | 543-551 | 9 | |
| α-helix | 560-563 | 4 | |
| α-helix | 567-569 | 3 | |
| α-helix | 570-571 | 2 | |
| β-strand | 572-573 | 2 | 4 |
| β-strand | 576-577 | 2 | 4 |
| β-strand | 579-581 | 3 | 5 |
| β-strand | 587-589 | 3 | 5 |
| β-strand | 595-596 | 2 | 3 |
| α-helix | 597-599 | 3 | |
| α-helix | 603-613 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Helicase domain from Genome polyprotein | A | protein | 438 | Zika virus (strain Mr 766) | A0A024B7W1 (AlphaFold model) |
>5Y6M_1 Helicase domain from Genome polyprotein (chains A) EPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAPTRVVAAEMEEALRGL PVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLYIMDEAHFTDPSSIAARG YISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEVPERAWSSGFDWVTDHSGKT VWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKTKHQEWDFVVTTDISEMGANFK ADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQRRGRIGRNPNKPGDEYLYGGGCAE TDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADKVAAIEGEFKLRTEQRKTFVELMKRG DLPVWLAYQVASAGITYTDRRWCFDGTTNNTIMEDSVPAEVWTRHGEKRVLKPRWMDARV CSDHAALKSFKEFAAGKR
| ID | Name | Formula | Copies |
|---|---|---|---|
| MN | Manganese (II) ion | Mn | 1 |
| AF3 | Aluminum fluoride | Al F3 | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
Mechanism of ATP hydrolysis by the Zika virus helicase. Yang, X., Chen, C., Tian, H. et al. FASEB J (2018) 32:5250-5257. DOI 10.1096/fj.201701140R · PubMed
Other PDB entries of the same protein (UniProt A0A024B7W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5Y6M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.