5YBU: KANK1 ankyrin domain

Structure of the KANK1 ankyrin domain in complex with KIF21A peptide. Determined by X-ray diffraction at 1.89 Å resolution. Released 6 Dec 2017.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,061
Mol. weight: 29.97 kDa
Released: 6 Dec 2017

Explore 5YBU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YBU contains 18 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1080-1083	4
α-helix	1087-1099	13
α-helix	1103-1106	4
α-helix	1109-1126	18
α-helix	1133-1146	14
α-helix	1148-1155	8
α-helix	1165-1171	7
α-helix	1175-1183	9
α-helix	1199-1205	7
α-helix	1211-1223	13
α-helix	1237-1243	7
α-helix	1247-1255	9
β-strand	1263	1	1
β-strand	1269	1	1
α-helix	1270-1277	8
α-helix	1280-1287	8
α-helix	1304-1310	7
α-helix	1314-1324	11

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1153-1155	3
α-helix	1160-1164	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KN motif and ankyrin repeat domain-containing protein 1	A	protein	253	Homo sapiens	Q14678 (AlphaFold model)
Kinesin-like protein KIF21A	B	protein	22	Homo sapiens	Q7Z4S6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5YBU_1 KN motif and ankyrin repeat domain-containing protein 1 (chains A)
GHMRERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRVSSQKSAIPAMV
GDYIAAFEAISPDVLRYVINLADGNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAG
YTPIMLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLAC
GADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDI
AVLLYAHVNFAKA

Sequence of entity 2 (B), FASTA

>5YBU_2 Kinesin-like protein KIF21A (chains B)
EVKPKNKARRRTTTQMELLYAD

Primary citation

Structural basis for the recognition of kinesin family member 21A (KIF21A) by the ankyrin domains of KANK1 and KANK2 proteins. Guo, Q., Liao, S., Zhu, Z. et al. J Biol Chem (2018) 293:557-566. DOI 10.1074/jbc.M117.817494 · PubMed

Other PDB entries of the same protein (UniProt Q14678 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IW0 2.1 Å, Crystal structure of the KANK1/liprin-beta1 complex
5YBJ 2.34 Å, Structure of apo KANK1 ankyrin domain
8IVZ 2.8 Å, Crystal structure of talin R7 in complex with KANK1 KN motif
8AS9 3.4 Å, Crystal structure of the talin-KANK1 complex

Browse structure collections

About this viewer

MolViewer shows 5YBU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.