8IVZ: Talin R7

Name: PDB 8IVZ: Crystal structure of talin R7 in complex with KANK1 KN motif
Published: 2023-11-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: protein binding

Crystal structure of talin R7 in complex with KANK1 KN motif. Determined by X-ray diffraction at 2.8 Å resolution. Released 8 Nov 2023.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 2,869
Mol. weight: 42.47 kDa
Released: 8 Nov 2023

Explore 8IVZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8IVZ contains 19 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	1360-1373	14
α-helix	1375-1378	4
α-helix	1389-1416	28
α-helix	1419-1449	31
α-helix	1587-1589	3
α-helix	1590-1622	33
α-helix	1627-1652	26

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	1361-1373	13
α-helix	1375-1378	4
α-helix	1389-1416	28
α-helix	1419-1449	31
α-helix	1590-1622	33
α-helix	1627-1651	25

Chains C and D: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	32-34	3	1
α-helix	35	1
α-helix	36-38	3
β-strand	40-42	3	1
α-helix	44-52	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A, B	protein	171	Mus musculus	P26039 (AlphaFold model)
KN motif and ankyrin repeat domains 1	C, D	protein	26	Homo sapiens	Q14678 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8IVZ_1 Talin-1 (chains A, B)
HMGSAPGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQ
NAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAQISPEGRAAMEPIVIS
AKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRD

Sequence of entity 2 (C, D), FASTA

>8IVZ_2 KN motif and ankyrin repeat domains 1 (chains C, D)
PYFVETPYGYQLDLDFLKYVDDIQKG

Primary citation

KANK1 shapes focal adhesions by orchestrating protein binding, mechanical force sensing, and phase separation. Guo, K., Zhang, J., Huang, P. et al. Cell Rep (2023) 42:113321-113321. DOI 10.1016/j.celrep.2023.113321 · PubMed

Other PDB entries of the same protein (UniProt P26039 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SR0 1.49 Å, Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with…
4W8P 1.5 Å, Crystal structure of RIAM TBS1 in complex with talin R7R8 domains
9DZ5 1.74 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
3DYJ 1.85 Å, Crystal Structure of the R11R12 Domains of Talin
8FSE 1.9 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain
3IVF 1.94 Å, Crystal structure of the talin head FERM domain
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
5IC0 1.97 Å, Structural analysis of a talin triple domain module
8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
2X0C 2.0 Å, Crystal Structure of the R7R8 domains of Talin
4F7G 2.05 Å, Crystal structure of talin autoinhibition complex

Browse structure collections

About this viewer

MolViewer shows 8IVZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.