Crystal structure of inner membrane protein Bqt4 in complex with telomeric protein Rap1. Determined by X-ray diffraction at 2.7 Å resolution. Released 14 Nov 2018.
Explore 5YC2 in 3D Show helices and sheets RCSB PDB PDBe
5YC2 contains 19 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-17 | 6 | 1 |
| β-strand | 22-27 | 6 | 1 |
| α-helix | 33-43 | 11 | |
| α-helix | 48-50 | 3 | |
| β-strand | 51-55 | 5 | 1 |
| β-strand | 58-59 | 2 | 1 |
| α-helix | 60-61 | 2 | |
| β-strand | 75-81 | 7 | 1 |
| α-helix | 89-91 | 3 | |
| α-helix | 99-101 | 3 | |
| β-strand | 106-112 | 7 | 2 |
| β-strand | 115-124 | 10 | 2 |
| β-strand | 133-138 | 6 | 2 |
| β-strand | 144-145 | 2 | 2 |
| α-helix | 146-153 | 8 | |
| α-helix | 159-172 | 14 | |
| β-strand | 176-178 | 3 | 2 |
| β-strand | 181-186 | 6 | 2 |
| α-helix | 188-198 | 11 | |
| α-helix | 201-208 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-15 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 14-17 | 4 | 3 |
| β-strand | 22-24 | 3 | 3 |
| α-helix | 34-43 | 10 | |
| α-helix | 48-50 | 3 | |
| β-strand | 51-55 | 5 | 3 |
| β-strand | 58-59 | 2 | 3 |
| β-strand | 75-81 | 7 | 3 |
| α-helix | 89-91 | 3 | |
| α-helix | 99-101 | 3 | |
| β-strand | 106-112 | 7 | 4 |
| β-strand | 115-125 | 11 | 4 |
| β-strand | 132-138 | 7 | 4 |
| β-strand | 144-145 | 2 | 4 |
| α-helix | 146-153 | 8 | |
| α-helix | 159-172 | 14 | |
| β-strand | 176-178 | 3 | 4 |
| β-strand | 181-186 | 6 | 4 |
| α-helix | 188-198 | 11 | |
| α-helix | 201-209 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-15 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-like protein SMT3,Bouquet formation protein 4 | A, C | protein | 207 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Schizosaccharomyces pombe (strain 972 / ATCC 24843) | O60158 (AlphaFold model), Q12306 (AlphaFold model) |
| DNA-binding protein rap1 | B, D | protein | 18 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | Q96TL7 (AlphaFold model) |
>5YC2_1 Ubiquitin-like protein SMT3,Bouquet formation protein 4 (chains A, C) GPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIEADQTP EDLDMEDNDIIEAHRSLPAERNPLYKDDTLDHTPLIPKCRAQVIEFPDGPATFVRLKCTN PESKVPHFLMRMAKDSSISATSMFRSAFPKATQEEEDLEMRWIRDNLNPIEDKRVAGLWV PPADALALAKDYSMTPFINALLEASST
>5YC2_2 DNA-binding protein rap1 (chains B, D) GPLDDEEAFEKQVTSSYS
Structural insights into chromosome attachment to the nuclear envelope by an inner nuclear membrane protein Bqt4 in fission yeast. Hu, C., Inoue, H., Sun, W. et al. Nucleic Acids Res (2019) 47:1573-1584. DOI 10.1093/nar/gky1186 · PubMed
Other PDB entries of the same protein (UniProt O60158 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5YC2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.