5YVI: Karyopherin beta2

Crystal structure of Karyopherin beta2 in complex with FUS(456-526). Determined by X-ray diffraction at 2.9 Å resolution. Released 16 May 2018.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,760
Mol. weight: 105.89 kDa
Released: 16 May 2018

Explore 5YVI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YVI contains 68 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 67 helices, 0 β-strands

Element	Residues	Length
α-helix	9-21	13
α-helix	29-40	12
α-helix	44-55	12
α-helix	62-79	18
α-helix	80-82	3
α-helix	87-96	10
α-helix	104-119	16
α-helix	123-125	3
α-helix	129-137	9
α-helix	142-159	18
α-helix	172-179	8
α-helix	180-184	5
α-helix	188-199	12
α-helix	207-210	4
α-helix	213-222	10
α-helix	229-245	17
α-helix	247-250	4
α-helix	251-253	3
α-helix	254-265	12
α-helix	270-285	16
α-helix	289-292	4
α-helix	293-295	3
α-helix	297-306	10
α-helix	310-311	2
α-helix	312-317	6
α-helix	375-390	16
α-helix	391-394	4
α-helix	395-405	11
α-helix	411-423	13
α-helix	429-432	4
α-helix	433-435	3
α-helix	436-446	11
α-helix	452-463	12
α-helix	466-471	6
α-helix	478-489	12
α-helix	494-511	18
α-helix	512-518	7
α-helix	519-532	14
α-helix	536-552	17
α-helix	553-556	4
α-helix	559-575	17
α-helix	583-597	15
α-helix	598-604	7
α-helix	605-628	24
α-helix	634-636	3
α-helix	639-655	17
α-helix	656-659	4
α-helix	660-664	5
α-helix	668-675	8
α-helix	681-697	17
α-helix	699-702	4
α-helix	703-705	3
α-helix	706-715	10
α-helix	722-739	18
α-helix	740-749	10
α-helix	751-758	8
α-helix	765-781	17
α-helix	783-786	4
α-helix	787-789	3
α-helix	790-801	12
α-helix	808-819	12
α-helix	825-827	3
α-helix	829-831	3
α-helix	832-840	9
α-helix	847-861	15
α-helix	870-873	4
α-helix	878-888	11

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	514-521	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transportin-1	A	protein	868	Homo sapiens	Q92973 (AlphaFold model)
RNA-binding protein FUS	B	protein	73	Homo sapiens	P35637 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5YVI_1 Transportin-1 (chains A)
GSMEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLK
SEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIA
SKGELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPK
FLQFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRA
LVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLP
KLIPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRGGSGGSGDTISDWNLRKCSAAA
LDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLPELIPH
LIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACS
AFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSVGHHLNKPEYI
QMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQ
AMLNNAQPDQYEAPDKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPE
VRQSSFALLGDLTKACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIE
MQPYIPMVLHQLVEIINRPNTPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLR
NIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKN
QVGDENWRRFSDQFPLPLKERLAAFYGV

Sequence of entity 2 (B), FASTA

>5YVI_2 RNA-binding protein FUS (chains B)
GSGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDS
RGEHRQDRRERPY

Primary citation

Nuclear Import Receptor Inhibits Phase Separation of FUS through Binding to Multiple Sites. Yoshizawa, T., Ali, R., Jiou, J. et al. Cell (2018) 173:693-705.e22. DOI 10.1016/j.cell.2018.03.003 · PubMed

Other PDB entries of the same protein (UniProt Q92973 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FDD 2.3 Å, Crystal structure of KAP beta2-PY-NLS
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
4OO6 2.7 Å, Crystal structure of human KAP-beta2 bound to the NLS of HCC1 (Hepato Cellular Carcinoma…
7CYL 2.7 Å, Crystal structure of Karyopherin-beta2 in complex with FUS PY-NLS(P525L)
1QBK 3.0 Å, Structure of the karyopherin BETA2-ran gppnhp nuclear transport complex
2QMR 3.0 Å, Karyopherin beta2/transportin
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
4FQ3 3.0 Å, Crystal structure of transportin/FUS-NLS
5TQC 3.0 Å, Crystal structure of transport factor karyopherin-beta 2 in complex with the PY-NLS of…
2H4M 3.05 Å, Karyopherin Beta2/Transportin-M9NLS
4JLQ 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the PY-NLS of Saccharomyces…
5J3V 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the histone H3 tail

Browse structure collections

About this viewer

MolViewer shows 5YVI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.