4JLQ: Human Karyopherin-beta2

Crystal structure of human Karyopherin-beta2 bound to the PY-NLS of Saccharomyces cerevisiae NAB2. Determined by X-ray diffraction at 3.05 Å resolution. Released 3 Apr 2013.

Method: X-ray diffraction
Resolution: 3.05 Å
Organisms: Homo sapiens, Saccharomyces cerevisiae S288c
Chains: 2
Atoms: 6,733
Mol. weight: 100.79 kDa
Released: 3 Apr 2013

Explore 4JLQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JLQ contains 64 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 64 helices, 0 β-strands

Element	Residues	Length
α-helix	9-22	14
α-helix	27-41	15
α-helix	46-55	10
α-helix	62-77	16
α-helix	85-97	13
α-helix	104-120	17
α-helix	129-137	9
α-helix	142-163	22
α-helix	166-168	3
α-helix	172-181	10
α-helix	182-184	3
α-helix	188-199	12
α-helix	207-210	4
α-helix	213-221	9
α-helix	229-245	17
α-helix	247-250	4
α-helix	251-253	3
α-helix	254-264	11
α-helix	270-283	14
α-helix	289-294	6
α-helix	297-307	11
α-helix	310-311	2
α-helix	312-317	6
α-helix	375-389	15
α-helix	391-394	4
α-helix	395-407	13
α-helix	411-424	14
α-helix	429-432	4
α-helix	433-435	3
α-helix	436-446	11
α-helix	452-464	13
α-helix	466-470	5
α-helix	474-478	5
α-helix	479-488	10
α-helix	494-511	18
α-helix	512-518	7
α-helix	519-532	14
α-helix	536-552	17
α-helix	553-556	4
α-helix	559-575	17
α-helix	577	1
α-helix	583-597	15
α-helix	598-604	7
α-helix	606-628	23
α-helix	638-654	17
α-helix	656-659	4
α-helix	660-664	5
α-helix	668-675	8
α-helix	681-698	18
α-helix	699-701	3
α-helix	703-705	3
α-helix	706-715	10
α-helix	722-739	18
α-helix	740-743	4
α-helix	748-759	12
α-helix	765-781	17
α-helix	783-786	4
α-helix	787-789	3
α-helix	790-801	12
α-helix	808-823	16
α-helix	827-830	4
α-helix	832-839	8
α-helix	847-873	27
α-helix	878-887	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transportin-1	A	protein	854	Homo sapiens	Q92973 (AlphaFold model)
Nuclear polyadenylated RNA-binding protein NAB2	B	protein	38	Saccharomyces cerevisiae S288c	P32505 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JLQ_1 Transportin-1 (chains A)
MEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSE
DEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASK
GELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFL
QFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALV
MLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKL
IPVLVNGMKYSDIDIILLKGDVEGGSGGSGDDTISDWNLRKCSAAALDVLANVYRDELLP
HILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRS
ITCWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELV
PYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNML
KDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQAMLNNAQPDQYEAP
DKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTK
ACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVE
IINRPNTPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRG
ICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQF
PLPLKERLAAFYGV

Sequence of entity 2 (B), FASTA

>4JLQ_2 Nuclear polyadenylated RNA-binding protein NAB2 (chains B)
RFTQRGGGAVGKNRRGGRGGNRGGRNNNSTRFNPLAKA

Primary citation

Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2. Soniat, M., Sampathkumar, P., Collett, G. et al. J Struct Funct Genomics (2013) 14:31-35. DOI 10.1007/s10969-013-9150-1 · PubMed

Other PDB entries of the same protein (UniProt Q92973 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FDD 2.3 Å, Crystal structure of KAP beta2-PY-NLS
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
4OO6 2.7 Å, Crystal structure of human KAP-beta2 bound to the NLS of HCC1 (Hepato Cellular Carcinoma…
7CYL 2.7 Å, Crystal structure of Karyopherin-beta2 in complex with FUS PY-NLS(P525L)
5YVI 2.9 Å, Crystal structure of Karyopherin beta2 in complex with FUS(456-526)
1QBK 3.0 Å, Structure of the karyopherin BETA2-ran gppnhp nuclear transport complex
2QMR 3.0 Å, Karyopherin beta2/transportin
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
4FQ3 3.0 Å, Crystal structure of transportin/FUS-NLS
5TQC 3.0 Å, Crystal structure of transport factor karyopherin-beta 2 in complex with the PY-NLS of…
2H4M 3.05 Å, Karyopherin Beta2/Transportin-M9NLS
5J3V 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the histone H3 tail

Browse structure collections

About this viewer

MolViewer shows 4JLQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.