5Z9W: Ebola virus nucleoprotein-RNA complex

Ebola virus nucleoprotein-RNA complex. Determined by electron microscopy at 3.6 Å resolution. Released 24 Oct 2018.

Method: Electron microscopy
Resolution: 3.6 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 3,177
Mol. weight: 45.29 kDa
Released: 24 Oct 2018

Explore 5Z9W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Z9W contains 25 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	23-26	4
β-strand	39-45	7	1
α-helix	50-62	13
α-helix	70-82	13
α-helix	87-90	4
α-helix	95-99	5
α-helix	100-102	3
β-strand	104-110	7	1
α-helix	117-120	4
α-helix	125-127	3
α-helix	128-135	8
α-helix	147-155	9
α-helix	165-181	17
α-helix	189-192	4
α-helix	194-206	13
α-helix	209-220	12
α-helix	227-238	12
α-helix	245-249	5
α-helix	250-254	5
β-strand	255-257	3	2
β-strand	262-264	3	2
α-helix	272-288	17
α-helix	294-296	3
α-helix	297-300	4
α-helix	303-305	3
α-helix	314-327	14
α-helix	331-333	3
α-helix	341-365	25
α-helix	370-405	36

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ebolavirus nucleoprotein (residues 19-406)	A	protein	388	Homo sapiens	P18272 (AlphaFold model)
RNA (6-mer)	R	RNA	6	synthetic construct

Sequence of entity 1 (A), FASTA

>5Z9W_1 Ebolavirus nucleoprotein (residues 19-406) (chains A)
MDYHKILTAGLSVQQGIVRQRVIPVYQVNNLEEICQLIIQAFEAGVDFQESADSFLLMLC
LHHAYQGDYKLFLESGAVKYLEGHGFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMP
EEETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMM
VIFRLMRTNFLIKFLLIHQGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKT
ERGVRLHPLARTAKVKNEVNSFKAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSA
IALGVATAHGSTLAGVNVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMN
FHQKKNEISFQQTNAMVTLRKERLAKLT

Sequence of entity 2 (R), FASTA

>5Z9W_2 RNA (6-MER) (chains R)
UUUUUU

Primary citation

Cryo-EM structure of the Ebola virus nucleoprotein-RNA complex at 3.6 angstrom resolution. Sugita, Y., Matsunami, H., Kawaoka, Y. et al. Nature (2018) 563:137-140. DOI 10.1038/s41586-018-0630-0 · PubMed

Other PDB entries of the same protein (UniProt P18272 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QB0 1.75 Å, The crystal structure of the C-terminal domain of Ebola (Zaire) nucleoprotein
4Z9P 1.79 Å, Crystal structure of Ebola virus nucleoprotein core domain at 1.8A resolution
4QAZ 1.98 Å, The crystal structure of the C-terminal domain of Ebola (Zaire) nucleoprotein
5T3T 2.2 Å, Ebola virus VP30 CTD bound to nucleoprotein
4ZTA 2.4 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide I212121
4ZTI 2.4 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide P212121
4ZTG 2.8 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide P22121
6NUT 3.1 Å, Ebola virus nucleoprotein - RNA complex
4YPI 3.71 Å, Structure of Ebola virus nucleoprotein N-terminal fragment bound to a peptide derived…
8Y9J 4.6 Å, Structure of the Ebola virus nucleocapsid subunit
6C54 5.8 Å, Ebola nucleoprotein nucleocapsid-like assembly and the asymmetric unit
6EHL 6.6 Å, Model of the Ebola virus nucleoprotein in recombinant nucleocapsid-like assemblies

Browse structure collections

About this viewer

MolViewer shows 5Z9W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.