5ZN9: PX domain

Crystal structure of PX domain. Determined by X-ray diffraction at 1.78 Å resolution. Released 10 Apr 2019.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,842
Mol. weight: 26.46 kDa
Released: 10 Apr 2019

Explore 5ZN9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ZN9 contains 12 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	174-181	8	1
β-strand	190-196	7	1
β-strand	199-205	7	1
α-helix	206-219	14
α-helix	225-229	5
α-helix	235-237	3
α-helix	238-256	19
α-helix	259-262	4
α-helix	265-270	6

Chain B: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	174-184	11	2
β-strand	187-196	10	2
β-strand	199-205	7	2
α-helix	206-219	14
α-helix	224-228	5
α-helix	235-237	3
α-helix	238-256	19
α-helix	259-262	4
α-helix	265-270	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-27	A, B	protein	110	Homo sapiens	Q96L92 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5ZN9_1 Sorting nexin-27 (chains A, B)
DYTEKQAVPISVPRYKHVEQNGEKFVVYNVYMAGRQLCSKRYREFAILHQNLKREFANFT
FPRLPGKWPFSLSEQQLDARRRGLEEYLEKVCSIRVIGESDIMQEFLSES

Primary citation

Crystal structure of PX domain. Li, Y., Zhu, Z., Li, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q96L92 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7E0B 1.29 Å, The crystal structure of sorting nexin 27 and PBM complex
4HAS 1.74 Å, Crystal structure of PX domain of human sorting nexin SNX27
7CT1 1.95 Å, Crystal structure of Snx27 FERM domain in complex with a DLF motif
6SAK 2.0 Å, Structure of the OTULINcat C129A - SNX27 PDZ domain complex.
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2
8TTV 2.0 Å, Structure of SNX27 FERM complexed with Fam21A repeat 20 (1289-1302)
7P72 2.15 Å, The PDZ domain of SNX27 complexed with the PDZ-binding motif of MERS-E
8TTT 2.35 Å, Structure of SNX27 FERM complexed with Fam21A repeat 15 (1124-1140)
8TTU 2.36 Å, Structure of SNX27 FERM complexed with Fam21A repeat 19 (1261 - 1274)

Browse structure collections

About this viewer

MolViewer shows 5ZN9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.