6ABO: Human XRCC4 and IFFO1 complex

human XRCC4 and IFFO1 complex. Determined by X-ray diffraction at 2.65 Å resolution. Released 31 Jul 2019.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,645
Mol. weight: 36.25 kDa
Released: 31 Jul 2019

Explore 6ABO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ABO contains 7 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	10	1	2
β-strand	18-24	7	1
α-helix	28-30	3
β-strand	32-37	6	1
β-strand	42-47	6	1
α-helix	49-57	9
α-helix	63-74	12
β-strand	83-89	7	2
β-strand	94-100	7	2
β-strand	105-112	8	2
β-strand	114-115	2	1
α-helix	116	1
α-helix	119-212	94

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	451-508	58
α-helix	510-523	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein XRCC4	A	protein	227	Homo sapiens	Q13426 (AlphaFold model)
Intermediate filament family orphan 1	B	protein	82	Homo sapiens	Q0D2I5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ABO_1 DNA repair protein XRCC4 (chains A)
MGSSHHHHHHSQGSMERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGT
VSESEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSF
RLGSFNLEKVENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCV
SAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEG

Sequence of entity 2 (B), FASTA

>6ABO_2 Intermediate filament family orphan 1 (chains B)
MARSMEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCS
MKRGLDVQMETCRRLITQSGDR

Primary citation

The nucleoskeleton protein IFFO1 immobilizes broken DNA and suppresses chromosome translocation during tumorigenesis. Li, W., Bai, X., Li, J. et al. Nat Cell Biol (2019) 21:1273-1285. DOI 10.1038/s41556-019-0388-0 · PubMed

Other PDB entries of the same protein (UniProt Q13426 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5E50 1.38 Å, APLF/XRCC4 complex
7M3P 2.0 Å, Xrcc4-Spc110p(164-207) fusion
3MUD 2.2 Å, Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle
1IK9 2.3 Å, Crystal structure of a XRCC4-DNA ligase IV complex
5CHX 2.3 Å, Crystal Structure of amino acids 1590-1657 of MYH7
5CJ0 2.3 Å, Crystal Structure of Amino Acids 1631-1692 of MYH7
4XA4 2.33 Å, Crystal Structure of the coiled-coil surrounding Skip 3 of MYH7
3II6 2.4 Å, Structure of human Xrcc4 in complex with the tandem BRCT domains of DNA LigaseIV.
5WJ7 2.5 Å, Crystal Structure of Amino Acids 1733-1797 of Human Beta Cardiac Myosin Fused to Xrcc4
1FU1 2.7 Å, Crystal structure of human XRCC4
9CQ3 2.8 Å, The gap-filling complex with Pol mu engaged in the NHEJ pathway
9N81 2.8 Å, A gap-filling complex with Pol mu engaged in the NHEJ Pathway

Browse structure collections

About this viewer

MolViewer shows 6ABO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.