6AC0: PDB entry 6AC0

Crystal structure of TRADD death domain GlcNAcylated by EPEC effector NleB. Determined by X-ray diffraction at 1.45 Å resolution. Released 1 May 2019.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,045
Mol. weight: 13.55 kDa
Ligands: NAG
Released: 1 May 2019

Explore 6AC0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AC0 contains 11 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	201-204	4	1
β-strand	207-210	4	1
β-strand	213	1	2
α-helix	214-215	2
α-helix	216-225	10
α-helix	227-229	3
α-helix	230-238	9
α-helix	242-244	3
α-helix	248-256	9
α-helix	257-259	3
α-helix	261-276	16
α-helix	277-279	3
β-strand	281	1	2
α-helix	282-291	10
α-helix	295-301	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor type 1-associated DEATH domain protein	A	protein	118	Homo sapiens	Q15628 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6AC0_1 Tumor necrosis factor receptor type 1-associated DEATH domain protein (chains A)
PPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAY
EYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Structural and Functional Insights into Host Death Domains Inactivation by the Bacterial Arginine GlcNAcyltransferase Effector. Ding, J., Pan, X., Du, L. et al. Mol Cell (2019) 74:922. DOI 10.1016/j.molcel.2019.03.028 · PubMed

Other PDB entries of the same protein (UniProt Q15628 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F3V 2.0 Å, Crystal structure of the complex between the N-terminal domain of TRADD and the TRAF…
9VGD 3.3 Å, Helical assembly of TRADD death domain
9VIN 3.41 Å, Ternary complex of TNFR1-DD, TRADD-DD and RIPK1-DD
1F2H Solution structure of the N-terminal domain of the TNFR1 associated protein, tradd.
5XME Solution structure of C-terminal domain of TRADD
7CSQ Solution structure of the complex between p75NTR-DD and TRADD-DD

Browse structure collections

About this viewer

MolViewer shows 6AC0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.