6AXD: DNA repair protein REV1

Structures of REV1 UBM2 domain complex with ubiquitin and with the first small-molecule that inhibits the REV1 UBM2-ubiquitin interaction. Determined by solution NMR. Released 27 Jun 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 260
Mol. weight: 7.81 kDa
Released: 27 Jun 2018

Explore 6AXD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AXD contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	43-45	3
α-helix	50-55	6
α-helix	58-70	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein REV1	A	protein	72	Homo sapiens	Q9UBZ9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6AXD_1 DNA repair protein REV1 (chains A)
MGSSHHHHHHHHLNGSSLVPRGSIKSSGLESNSDAGINLIALPAFSQVDPEVFAALPAEL
QRELKAAYDQRQ

Primary citation

Structures of REV1 UBM2 Domain Complex with Ubiquitin and with a Small-Molecule that Inhibits the REV1 UBM2-Ubiquitin Interaction. Vanarotti, M., Grace, C.R., Miller, D.J. et al. J Mol Biol (2018) 430:2857-2872. DOI 10.1016/j.jmb.2018.05.042 · PubMed

Other PDB entries of the same protein (UniProt Q9UBZ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EXT 1.9 Å, Structure of polymerase-interacting domain of human Rev1 in complex with translesional…
6WS0 2.24 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
6ASR 2.36 Å, REV1 UBM2 domain complex with ubiquitin
6WS5 2.47 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
3GQC 2.5 Å, Structure of human Rev1-DNA-dNTP ternary complex
4GK0 2.7 Å, Crystal structure of human Rev3-Rev7-Rev1 complex
9VGW 2.7 Å, Crystal structure of human PCNA in complex with REV1 PIP-box
4BA9 2.73 Å, The structural basis for the coordination of Y-family Translesion DNA Polymerases by Rev1
3VU7 2.8 Å, Crystal structure of REV1-REV7-REV3 ternary complex
4GK5 3.21 Å, Crystal structure of human Rev3-Rev7-Rev1-Polkappa complex
2EBW Solution structure of the BRCT domain from human DNA repair protein REV1
2LSI Solution structure of polymerase-interacting domain of human Rev1 in complex with…

Browse structure collections

About this viewer

MolViewer shows 6AXD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.