6BQN: ENaC

Cryo-EM structure of ENaC. Determined by electron microscopy at 3.9 Å resolution. Released 10 Oct 2018.

Method: Electron microscopy
Resolution: 3.9 Å
Organisms: Homo sapiens, Mus musculus
Chains: 7
Atoms: 12,737
Mol. weight: 203.62 kDa
Released: 10 Oct 2018

Explore 6BQN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BQN contains 53 α-helices and 114 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	81-84	4
α-helix	96-105	10
β-strand	114-120	7	1
β-strand	126	1	2
α-helix	127-129	3
β-strand	130-133	4	3
β-strand	136	1	4
α-helix	144-160	17
β-strand	227-228	2	5
β-strand	237-238	2	5
α-helix	244-259	16
α-helix	260-262	3
α-helix	274-276	3
β-strand	279-284	6	1
β-strand	287	1	1
β-strand	295-296	2	3
β-strand	299	1	4
β-strand	303	1	4
β-strand	305-307	3	3
β-strand	318	1	2
β-strand	328-333	6	1
β-strand	349-353	5	3
β-strand	367-369	3	3
β-strand	373-385	13	1
β-strand	394-395	2	6
α-helix	414-428	15
α-helix	443-445	3
α-helix	453-464	12
α-helix	471-474	4
β-strand	477-478	2	6
β-strand	480-487	8	1
β-strand	490-492	3	1
α-helix	498-510	13
β-strand	521-528	8	1
β-strand	534-540	7	1
α-helix	549-558	10
α-helix	561-568	8

Chain B: 18 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	49-74	26
β-strand	79-84	6	7
β-strand	90-91	2	8
α-helix	92-93	2
β-strand	94-99	6	9
β-strand	103	1	10
α-helix	105-107	3
α-helix	113-127	15
α-helix	142-145	4
β-strand	150-154	5	11
β-strand	189-193	5	11
β-strand	195	1	12
β-strand	204	1	12
β-strand	207	1	11
α-helix	214-229	16
α-helix	232-237	6
β-strand	239	1	10
α-helix	242-245	4
β-strand	246-250	5	7
β-strand	255	1	7
β-strand	262-266	5	9
β-strand	270-274	5	9
β-strand	285-286	2	8
β-strand	295-300	6	7
α-helix	303-305	3
β-strand	316-321	6	9
β-strand	334-336	3	9
β-strand	340-352	13	7
α-helix	355-358	4
α-helix	371-372	2
α-helix	384-398	15
β-strand	402	1	13
α-helix	407-409	3
β-strand	414	1	13
α-helix	423-431	9
α-helix	434-443	10
β-strand	449-452	4	7
β-strand	455-461	7	7
α-helix	471-475	5
β-strand	492-511	20	7
α-helix	516-520	5
α-helix	521-540	20

Chain C: 16 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	52-78	27
β-strand	81-88	8	14
β-strand	92-93	2	15
α-helix	94-95	2
β-strand	96-100	5	16
α-helix	115-128	14
β-strand	161-162	2	17
β-strand	202-206	5	17
β-strand	215-219	5	17
α-helix	222-237	16
α-helix	243-249	7
β-strand	259-262	4	14
β-strand	265-266	2	14
β-strand	273-277	5	16
β-strand	281-286	6	16
α-helix	293-295	3
β-strand	296-297	2	15
α-helix	302-304	3
β-strand	306-309	4	14
β-strand	328-332	5	16
β-strand	345-346	2	16
β-strand	352-362	11	14
β-strand	372	1	18
α-helix	391-406	16
β-strand	410	1	19
α-helix	415-417	3
β-strand	422	1	19
α-helix	431-443	13
α-helix	449-452	4
β-strand	455	1	18
β-strand	459-462	4	14
β-strand	465-469	5	14
α-helix	480-487	8
α-helix	495-497	3
α-helix	498-500	3
β-strand	503-520	18	14
α-helix	529-540	12
α-helix	542-550	9

Chain D: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	24-26	3	20
β-strand	30-33	4	21
β-strand	37-45	9	20
α-helix	52-53	2
β-strand	54-56	3	22
β-strand	66-69	4	22
β-strand	73-74	2	22
β-strand	90-98	9	20
β-strand	107-110	4	22
β-strand	117-118	2	22
β-strand	123-126	4	21

Chain E: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	23
β-strand	11-12	2	24
β-strand	18	1	23
β-strand	21-24	4	23
β-strand	34-39	6	25
β-strand	46	1	22
β-strand	47-51	5	25
α-helix	53-55	3
β-strand	58-59	2	25
β-strand	68-73	6	23
β-strand	78-83	6	23
α-helix	88-90	3
β-strand	93-99	7	25
β-strand	109-112	4	25
β-strand	119-120	2	24

Chain F: 0 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	26
β-strand	10-11	2	27
β-strand	19	1	28
β-strand	22-25	4	26
β-strand	33-37	5	29
β-strand	47-52	6	29
β-strand	57-60	4	29
β-strand	71-73	3	26
β-strand	78-80	3	26
β-strand	82	1	28
β-strand	93	1	30
β-strand	95-99	5	29
β-strand	113	1	30
β-strand	114-115	2	27

Chain G: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	31
β-strand	10	1	32
β-strand	23-25	3	31
β-strand	38-43	6	32
β-strand	53-54	2	32
β-strand	76	1	31
α-helix	85-87	3
β-strand	90-95	6	32
α-helix	101-102	2
β-strand	107-108	2	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SCNN1A	A	protein	489	Homo sapiens	P37088 (AlphaFold model)
SCNN1B	B	protein	495	Homo sapiens	P51168 (AlphaFold model)
EGFP-SCNN1G chimera	C	protein	503	Homo sapiens	P51170 (AlphaFold model)
7B1 fab	D	protein	106	Mus musculus
7B1 fab	E	protein	121	Mus musculus
10D4 fab	F	protein	115	Mus musculus
10D4 fab	G	protein	112	Mus musculus

Sequence of entity 1 (A), FASTA

>6BQN_1 SCNN1A (chains A)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSYPVSLNINLNSDKLVFPAVTICTLNPYRYP
EIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRADLRGTLPHPLQALAVPPPPHGAA
AAASVASSLRDNNPQVDWKDWKIGFQLCNQNKSDCFYQTYSSGVDAVAEWYAFHYINILS
RLPETLPSLEEDTLGNFIFACRFNQVSCNQANYSHFHHPMYGNCYTFNDKNNSNLWMSSM
PGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRK
ETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQN
VEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEW
VFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTXXXXXXXXXXXXXXXXXX
XXXXXXXXX

Sequence of entity 2 (B), FASTA

>6BQN_2 SCNN1B (chains B)
XXXXXXXXXXXXXXXXXXXXXXXXXTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSK
IKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLF
GDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIF
AQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSA
NPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVL
VDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYP
LPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEAS
EDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIXXXXXXXXXXXX
XXXXXXXXXXXXXXX

Sequence of entity 3 (C), FASTA

>6BQN_3 EGFP-SCNN1G chimera (chains C)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXFYTVSVSIKVHFRKLDFPAVTICNINPYKYS
TVRHLLADLEQETREALKSLYGFPESAAAAEAESWNSVSEGKQPRFSHRIPLLIFDQDEK
GKARDFFTGQQQQVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCATYTFSSGINAIQE
WYKLHYMNIMAQVPLEKKINMSYSAEELLVTCFFDGVSCDARNFTLFHHPMHGNCYTFNN
RENETILSTSMGGSEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIE
TAMVTSIGMHLTESFKLSEPYSQCTEDGSDVPIRNIYNAAYSLQICLHSCFQTKMVEKCG
CAQYSQPLPPAANYCNYQQHPNWMYCYYQLHRAFVQEELGCQSVCKEACSFKEWTLTTSL
AQWPSVVSEKWLLPVLTWDQGRQVNKKLNKTDLAKLLIFYKDLNQRSIMESPANSIXXXX
XXXXXXXXXXXXXXXXXXXXXXX

Sequence of entity 4 (D), FASTA

>6BQN_4 7B1 fab (chains D)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Sequence of entity 5 (E), FASTA

>6BQN_5 7B1 fab (chains E)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
X

Sequence of entity 6 (F), FASTA

>6BQN_6 10D4 fab (chains F)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Sequence of entity 7 (G), FASTA

>6BQN_7 10D4 fab (chains G)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Primary citation

Structure of the human epithelial sodium channel by cryo-electron microscopy. Noreng, S., Bharadwaj, A., Posert, R. et al. Elife (2018) 7. DOI 10.7554/eLife.39340 · PubMed

Other PDB entries of the same protein (UniProt P37088 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WTH 3.06 Å, Full-length human ENaC ECD
2M3O Structure and dynamics of a human Nedd4 WW domain-ENaC complex

Browse structure collections

About this viewer

MolViewer shows 6BQN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.