6WTH: Full-length human ENaC ECD

Full-length human ENaC ECD. Determined by electron microscopy at 3.06 Å resolution. Released 12 Aug 2020.

Method: Electron microscopy
Resolution: 3.06 Å
Organisms: Homo sapiens, Mus musculus
Chains: 7
Atoms: 11,740
Mol. weight: 264.77 kDa
Ligands: NAG
Released: 12 Aug 2020

Explore 6WTH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WTH contains 47 α-helices and 123 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	115-121	7	1
β-strand	125-126	2	2
α-helix	127-128	2
β-strand	129-134	6	3
α-helix	137-140	4
α-helix	144-161	18
β-strand	188-190	3	4
β-strand	224-228	5	4
β-strand	237-241	5	4
α-helix	244-260	17
α-helix	267-268	2
β-strand	279-284	6	1
β-strand	287-288	2	1
β-strand	294-298	5	3
β-strand	304-308	5	3
β-strand	318-319	2	2
β-strand	328-332	5	1
β-strand	349-354	6	3
α-helix	362-365	4
β-strand	367-369	3	3
β-strand	373-385	13	1
β-strand	395	1	5
α-helix	413-429	17
β-strand	432	1	6
β-strand	444	1	6
α-helix	454-465	12
α-helix	471-474	4
α-helix	476-477	2
β-strand	478	1	5
β-strand	480-492	13	1
α-helix	499-509	11
β-strand	522-528	7	1
β-strand	533-539	7	1

Chain B: 19 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	79-86	8	7
β-strand	90-91	2	8
α-helix	92-93	2
β-strand	94-99	6	9
α-helix	105-107	3
α-helix	113-126	14
α-helix	142-145	4
β-strand	150-154	5	10
β-strand	162-165	4	10
α-helix	182-184	3
β-strand	189-196	8	10
β-strand	203-208	6	10
α-helix	211-227	17
α-helix	232-236	5
α-helix	242-245	4
β-strand	246-251	6	7
β-strand	254-255	2	7
α-helix	258-260	3
β-strand	262-266	5	9
β-strand	270-274	5	9
α-helix	282-284	3
β-strand	285-286	2	8
α-helix	291-293	3
β-strand	295-300	6	7
α-helix	303-305	3
β-strand	316-321	6	9
β-strand	334	1	9
β-strand	340	1	11
β-strand	341-352	12	7
β-strand	361-362	2	12
α-helix	371-372	2
α-helix	375-377	3
α-helix	379-381	3
α-helix	383-398	16
β-strand	402	1	13
β-strand	414	1	13
α-helix	423-431	9
α-helix	434-443	10
β-strand	446-447	2	12
β-strand	449-453	5	7
β-strand	456-458	3	7
β-strand	461	1	11
α-helix	468-480	13
β-strand	492-511	20	7

Chain C: 17 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	81-89	9	14
β-strand	92-93	2	15
β-strand	96-97	2	16
β-strand	98-99	2	17
β-strand	100-101	2	18
β-strand	105	1	19
α-helix	115-124	10
α-helix	125-129	5
β-strand	161-163	3	20
β-strand	201-207	7	20
β-strand	214-219	6	20
α-helix	222-237	16
α-helix	238-240	3
α-helix	243-249	7
β-strand	250	1	19
α-helix	253-256	4
β-strand	257-259	3	21
β-strand	262	1	21
β-strand	265	1	21
α-helix	269-271	3
β-strand	273-277	5	17
β-strand	281-285	5	17
α-helix	293-295	3
β-strand	296-297	2	15
β-strand	306-311	6	21
α-helix	314-316	3
β-strand	325	1	1
β-strand	326-329	4	18
β-strand	331-332	2	16
α-helix	337-338	2
α-helix	340-343	4
β-strand	345-348	4	18
β-strand	352-357	6	21
β-strand	359-363	5	14
α-helix	366-370	5
β-strand	373	1	22
α-helix	391-406	16
β-strand	410	1	23
α-helix	415-417	3
β-strand	422	1	23
α-helix	432-443	12
β-strand	456	1	22
β-strand	459-462	4	14
β-strand	465-469	5	21
α-helix	477-487	11
α-helix	495-497	3
β-strand	501-508	8	21
β-strand	512-520	9	14

Chain D: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	24
β-strand	20-25	6	24
β-strand	34-39	6	25
β-strand	45-49	5	25
β-strand	55	1	25
β-strand	63-65	3	24
β-strand	71-76	6	24
β-strand	86-91	6	25
β-strand	99	1	25
β-strand	103-104	2	25

Chain E: 0 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	26
β-strand	7	1	27
β-strand	12	1	28
β-strand	17-23	7	27
β-strand	24	1	26
β-strand	34-39	6	29
β-strand	45-51	7	29
β-strand	58-60	3	29
β-strand	68-72	5	27
β-strand	78-84	7	27
β-strand	93-99	7	29
β-strand	109-112	4	29
β-strand	120	1	28

Chain F: 0 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	30
β-strand	18-25	8	30
β-strand	33	1	31
β-strand	34	1	32
β-strand	36	1	31
β-strand	37-40	4	33
β-strand	45	1	33
β-strand	49-52	4	31
β-strand	57-60	4	31
β-strand	68-73	6	30
β-strand	78-83	6	30
β-strand	92-95	4	33
β-strand	98	1	32
β-strand	107	1	32
β-strand	112-114	3	33

Chain G: 0 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	34
β-strand	22-25	4	34
β-strand	30	1	35
β-strand	36	1	35
β-strand	41-42	2	36
β-strand	50-51	2	36
β-strand	76-77	2	34

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amiloride-sensitive sodium channel subunit alpha	A	protein	669	Homo sapiens	P37088 (AlphaFold model)
Amiloride-sensitive sodium channel subunit beta	B	protein	640	Homo sapiens	P51168 (AlphaFold model)
Amiloride-sensitive sodium channel subunit gamma	C	protein	649	Homo sapiens	P51170 (AlphaFold model)
7B1 Fab	D, E	protein	118	Mus musculus
10D4 Fab	F, G	protein	115	Mus musculus

Sequence of entity 1 (A), FASTA

>6WTH_1 Amiloride-sensitive sodium channel subunit alpha (chains A)
MEGNKLEEQDSSPPQSTPGLMKGNKREEQGLGPEPAAPQQPTAEEEALIEFHRSYRELFE
FFCNNTTIHGAIRLVCSQHNRMKTAFWAVLWLCTFGMMYWQFGLLFGEYFSYPVSLNINL
NSDKLVFPAVTICTLNPYRYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDL
RGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQLCNQNKSDCFYQT
YSSGVDAVREWYRFHYINILSRLPETLPSLEEDTLGNFIFACRFNQVSCNQANYSHFHHP
MYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPA
FMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSC
FQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCS
VTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESP
SVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGR
GAQEVASTLASSPPSHFCPHPMSLSLSQPGPAPSPALTAPPPAYATLGPRPSPGGSAGAS
SSTCPLGGP

Sequence of entity 2 (B), FASTA

>6WTH_2 Amiloride-sensitive sodium channel subunit beta (chains B)
MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFA
ALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELME
AVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSAS
EKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSY
PGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILD
IGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSP
CTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDF
PDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERD
QSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEF
GEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPN
TGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

Sequence of entity 3 (C), FASTA

>6WTH_3 Amiloride-sensitive sodium channel subunit gamma (chains C)
MAPGEKIKAKIKKNLPVTGPQAPTIKELMRWYCLNTNTHGCRRIVVSRGRLRRLLWIGFT
LTAVALILWQCALLVFSFYTVSVSIKVHFRKLDFPAVTICNINPYKYSTVRHLLADLEQE
TREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKR
KVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQ
VPLEKKINMSYSAEELLVTCFFDGVSCDARNFTLFHHPMHGNCYTFNNRENETILSTSMG
GSEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLT
ESFKLSEPYSQCTEDGSDVPIRNIYNAAYSLQICLHSCFQTKMVEKCGCAQYSQPLPPAA
NYCNYQQHPNWMYCYYQLHRAFVQEELGCQSVCKEACSFKEWTLTTSLAQWPSVVSEKWL
LPVLTWDQGRQVNKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWMS
CSVVCVIEIIEVFFIDFFSIIARRQWQKAKEWWAWKQAPPCPEAPRSPQGQDNPALDIDD
DLPTFNSALHLPPALGTQVPGTPPPKYNTLRLERAFSNQLTDTQMLDEL

Sequence of entity 4 (D, E), FASTA

>6WTH_4 7B1 Fab (chains D, E)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Sequence of entity 5 (F, G), FASTA

>6WTH_5 10D4 Fab (chains F, G)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Water and common crystallization additives (NA) are not listed.

Primary citation

Molecular principles of assembly, activation, and inhibition in epithelial sodium channel. Noreng, S., Posert, R., Bharadwaj, A. et al. Elife (2020) 9. DOI 10.7554/eLife.59038 · PubMed

Other PDB entries of the same protein (UniProt P37088 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BQN 3.9 Å, Cryo-EM structure of ENaC
2M3O Structure and dynamics of a human Nedd4 WW domain-ENaC complex

Browse structure collections

About this viewer

MolViewer shows 6WTH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.