6BRC: Human CAMKK2B

Crystal Structure of the Human CAMKK2B in complex with AP26113-analog (ALK-IN-1). Determined by X-ray diffraction at 2.2 Å resolution. Released 13 Dec 2017.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,120
Mol. weight: 67.34 kDa
Ligands: E5J
Released: 13 Dec 2017

Explore 6BRC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BRC contains 26 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	161-162	2	1
β-strand	165-173	9	1
β-strand	178-184	7	1
β-strand	189-197	9	1
α-helix	198-203	6
α-helix	232-241	10
β-strand	248	1	2
β-strand	251-256	6	1
β-strand	262-268	7	1
β-strand	274	1	2
α-helix	283-285	3
α-helix	286-305	20
β-strand	308-309	2	3
α-helix	315-317	3
β-strand	318-320	3	2
β-strand	326-328	3	2
β-strand	335-336	2	3
β-strand	343-344	2	4
α-helix	351-353	3
α-helix	356-358	3
β-strand	366-367	2	4
α-helix	368-385	18
α-helix	395-404	10
α-helix	405-407	3
α-helix	417-426	10
α-helix	437-441	5
α-helix	444-447	4

Chain B: 13 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	162	1	5
β-strand	165-173	9	5
β-strand	178-184	7	5
β-strand	189-197	9	5
α-helix	198-202	5
α-helix	233-241	9
β-strand	248	1	6
β-strand	251-256	6	5
β-strand	262-268	7	5
β-strand	274	1	6
α-helix	283-285	3
α-helix	286-305	20
β-strand	308-309	2	7
α-helix	315-317	3
β-strand	318-320	3	6
β-strand	326-328	3	6
β-strand	335-336	2	7
β-strand	343-344	2	8
α-helix	351-353	3
α-helix	356-358	3
β-strand	366-367	2	8
α-helix	368-385	18
α-helix	395-404	10
α-helix	405-407	3
α-helix	417-426	10
α-helix	437-441	5
α-helix	444-447	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium/calmodulin-dependent protein kinase kinase 2	A, B	protein	291	Homo sapiens	Q96RR4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6BRC_1 Calcium/calmodulin-dependent protein kinase kinase 2 (chains A, B)
SMQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRP
APGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEV
PTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFK
GSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCL
HSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRH

Ligands and cofactors

ID	Name	Formula	Copies
E5J	5-chloro-N~2~-{4-[4-(dimethylamino)piperidin-1-yl]-2-methoxyphenyl}-N~4~-[2-(di…	C26 H34 Cl N6 O2 P	2

Water and common crystallization additives (NA) are not listed.

Primary citation

Crystal Structure of the Human CAMKK2B in complex with AP26113-analog (ALK-IN-1). Counago, R.M., dos Reis, C.V., de Souza, G.P. et al. To be published.

Other PDB entries of the same protein (UniProt Q96RR4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Y3O 1.5 Å, 14-3-3 Sigma in complex with phosphorylated CAMKK2 peptide
6Y8A 1.5 Å, 14-3-3 Sigma in complex with phosphorylated camkk2{pS511} peptide
8TUC 1.5 Å, Unphosphorylated CaMKK2 in complex with CC-8977
5UYJ 1.6 Å, Crystal Structure of the Human CAMKK2B
5UY6 1.7 Å, Crystal Structure of the Human CAMKK2B
6BQQ 1.8 Å, Crystal Structure of the Human CAMKK2B in complex with BI2526
5VT1 1.9 Å, Crystal Structure of the Human CAMKK2B bound to a thiadiazinone benzamide inhibitor
6BLE 1.9 Å, Crystal Structure of the Human CAMKK2B in complex with CP673451
5YV8 1.93 Å, Structure of CaMKK2 in complex with CKI-002
6BQP 1.95 Å, Crystal Structure of the Human CAMKK2B in complex with Crenolanib
6BKU 2.0 Å, Crystal Structure of the Human CAMKK2B bound to GSK650394
6BQL 2.0 Å, Crystal Structure of the Human CAMKK2B in complex with TAE-226

Browse structure collections

About this viewer

MolViewer shows 6BRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.