Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423 bound to the 22D11 broadly neutralizing antibody. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Jun 2018.
Explore 6BZY in 3D Show helices and sheets RCSB PDB PDBe
6BZY contains 17 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 414 | 1 | 13 |
| β-strand | 421 | 1 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 11-12 | 2 | 2 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 32-39 | 8 | 3 |
| β-strand | 46-51 | 6 | 3 |
| β-strand | 57-59 | 3 | 3 |
| α-helix | 64-66 | 3 | |
| β-strand | 67-72 | 6 | 1 |
| α-helix | 73-75 | 3 | |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-96 | 9 | 3 |
| β-strand | 102-103 | 2 | 3 |
| β-strand | 107-109 | 3 | 3 |
| β-strand | 110-111 | 2 | 2 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 4 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 5 |
| β-strand | 135-145 | 11 | 5 |
| β-strand | 146 | 1 | 4 |
| β-strand | 151-154 | 4 | 6 |
| α-helix | 155-157 | 3 | |
| β-strand | 159 | 1 | 6 |
| β-strand | 163-165 | 3 | 5 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-171 | 3 | 5 |
| β-strand | 175-185 | 11 | 5 |
| β-strand | 195-200 | 6 | 6 |
| α-helix | 201-203 | 3 | |
| β-strand | 205-210 | 6 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 7 |
| β-strand | 10-14 | 5 | 8 |
| β-strand | 19-25 | 7 | 7 |
| β-strand | 27C-27D | 2 | 9 |
| β-strand | 30-31 | 2 | 9 |
| β-strand | 33-38 | 6 | 8 |
| β-strand | 45-49 | 5 | 8 |
| β-strand | 53-54 | 2 | 8 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 7 |
| β-strand | 70-75 | 6 | 7 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 8 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 8 |
| β-strand | 102-107 | 6 | 8 |
| β-strand | 111 | 1 | 10 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 11 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 11 |
| β-strand | 140 | 1 | 10 |
| β-strand | 145-150 | 6 | 12 |
| β-strand | 153-155 | 3 | 12 |
| β-strand | 159-163 | 5 | 11 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 11 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-197 | 7 | 12 |
| β-strand | 205-210 | 6 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 22D11 Heavy Chain | H | protein | 220 | Mus musculus | |
| 22D11 Light Chain | L | protein | 218 | Mus musculus | |
| E2 AS412 peptide | B | protein | 13 | Hepacivirus C | P27958 (AlphaFold model) |
>6BZY_1 22D11 Heavy Chain (chains H) EVQLLESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLGAIWSAGNTNYN SALMSRLSISRDNSKSQVFLKMNSLQTDDTAMYYCACAPIYYDYTWFAYWGQGTLVTVSA AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLTSGVHTFPAVLQSD LYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
>6BZY_2 22D11 Light Chain (chains L) EIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQKPGQPPKLLIYAASNQGS GVPARFSGSGSGTDFSLNIHPMEEDDTAMYFCQQSKEVPYTFGGGTKLEIKRADAAPTVS IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>6BZY_3 E2 AS412 peptide (chains B) RQLINTNGSWHIN
Immunogenetic and structural analysis of a class of HCV broadly neutralizing antibodies and their precursors. Aleman, F., Tzarum, N., Kong, L. et al. Proc Natl Acad Sci U S A (2018) 115:7569-7574. DOI 10.1073/pnas.1802378115 · PubMed
Other PDB entries of the same protein (UniProt P27958 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6BZY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.