6C4S: Human cSrc SH3 Domain

Human cSrc SH3 Domain in complex with Choline Kinase fragment 60-69. Determined by X-ray diffraction at 1.5 Å resolution. Released 23 Jan 2019.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,299
Mol. weight: 16.47 kDa
Ligands: ZN
Released: 23 Jan 2019

Explore 6C4S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6C4S contains 5 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	89-91	3	1
β-strand	95	1	2
β-strand	102	1	1
β-strand	105	1	2
β-strand	110-115	6	1
β-strand	121-126	6	1
β-strand	132-136	5	1
α-helix	137-139	3
β-strand	140-142	3	1
α-helix	147-152	6

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	89-91	3	3
β-strand	95	1	4
β-strand	102	1	3
β-strand	105	1	4
β-strand	110-115	6	3
β-strand	121-126	6	3
β-strand	132-136	5	3
α-helix	137-139	3
β-strand	140-142	3	3
α-helix	147-153	7
α-helix	156-157	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proto-oncogene tyrosine-protein kinase Src,cSrc SH3 Domain	A, B	protein	74	Homo sapiens	P12931 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6C4S_1 Proto-oncogene tyrosine-protein kinase Src,cSrc SH3 Domain (chains A, B)
HMTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD
GGGLPPPLPLPLPL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Molecular basis for the interaction between human choline kinase alpha and the SH3 domain of the c-Src tyrosine kinase. Kall, S.L., Whitlatch, K., Smithgall, T.E. et al. Sci Rep (2019) 9:17121-17121. DOI 10.1038/s41598-019-53447-0 · PubMed

Other PDB entries of the same protein (UniProt P12931 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OFX 1.45 Å, Crystal structure of c-Src SH3 domain in H32 space group mediated by nickel
1FMK 1.5 Å, Crystal structure of human tyrosine-protein kinase C-src
1O43 1.5 Å, Crystal structure of SH2 in complex with RU82129.
1O4A 1.5 Å, Crystal structure of SH2 in complex with RU82197.
1O4R 1.5 Å, Crystal structure of SH2 in complex with RU78783.
2SRC 1.5 Å, Crystal structure of human tyrosine-protein kinase C-src, in complex with AMP-pnp
7NG7 1.5 Å, Src kinase bound to eCF506 trapped in inactive conformation
8VCF 1.5 Å, Crystal structure of Superbinder Src SH2 domain with Cysteine to Serine mutations
1O48 1.55 Å, Crystal structure of SH2 in complex with RU85053.
1O4G 1.55 Å, Crystal structure of SH2 in complex with DPI59.
1O4K 1.57 Å, Crystal structure of SH2 in complex with pasbn.
4F5B 1.57 Å, Triple mutant Src SH2 domain bound to phosphotyrosine

Browse structure collections

About this viewer

MolViewer shows 6C4S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.