6C9L: MEF2B Apo Protein Structure
MEF2B Apo Protein Structure. Determined by X-ray diffraction at 2.3 Å resolution. Released 7 Feb 2018.
- Method
- X-ray diffraction
- Resolution
- 2.3 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 4,098
- Mol. weight
- 66.23 kDa
- Released
- 7 Feb 2018
Explore 6C9L in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6C9L contains 23 α-helices and 16 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 1 |
| β-strand | 54-58 | 5 | 1 |
| α-helix | 62-71 | 10 | |
| α-helix | 75-76 | 2 | |
| β-strand | 77-80 | 4 | 1 |
| α-helix | 81-89 | 9 | |
Chain B: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-10 | 3 | |
| α-helix | 14-16 | 3 | |
| α-helix | 17-39 | 23 | |
| β-strand | 42-48 | 7 | 1 |
| β-strand | 54-58 | 5 | 1 |
| α-helix | 62-71 | 10 | |
| β-strand | 77-80 | 4 | 1 |
| α-helix | 81-89 | 9 | |
Chain C: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-10 | 3 | |
| α-helix | 14-16 | 3 | |
| α-helix | 17-39 | 23 | |
| β-strand | 42-48 | 7 | 2 |
| β-strand | 54-58 | 5 | 2 |
| α-helix | 62-71 | 10 | |
| β-strand | 77-80 | 4 | 2 |
| α-helix | 81-88 | 8 | |
Chain D: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 2 |
| β-strand | 54-58 | 5 | 2 |
| α-helix | 62-71 | 10 | |
| α-helix | 75-76 | 2 | |
| β-strand | 77-79 | 3 | 2 |
| α-helix | 81-89 | 9 | |
Chain E: 2 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 3 |
| β-strand | 54-58 | 5 | 3 |
| α-helix | 62-71 | 10 | |
Chain F: 3 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 3 |
| β-strand | 54-58 | 5 | 3 |
| α-helix | 62-72 | 11 | |
| α-helix | 81-88 | 8 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Myocyte-specific enhancer factor 2B | A, B, C, D, E, F | protein | 93 | Homo sapiens | Q02080 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>6C9L_1 Myocyte-specific enhancer factor 2B (chains A, B, C, D, E, F)
MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYAST
DMDRVLLKYTEYSEPHESRTNTDILETLKRRGI
Primary citation
Crystal Structure of Apo MEF2B Reveals New Insights in DNA Binding and Cofactor Interaction. Lei, X., Shi, H., Kou, Y. et al. Biochemistry (2018) 57:4047-4051. DOI 10.1021/acs.biochem.8b00439 · PubMed
Other PDB entries of the same protein (UniProt Q02080 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6WC2 2.1 Å, Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex
- 1N6J 2.2 Å, Structural basis of sequence-specific recruitment of histone deacetylases by Myocyte…
- 6BYY 2.3 Å, MEF2 CHIMERA/DNA Complex
- 1TQE 2.7 Å, Mechanism of recruitment of class II histone deacetylases by myocyte enhancer factor-2
- 6WC5 2.9 Å, Crystal Structure of a Ternary MEF2B/NKX2-5/myocardin enhancer DNA Complex
- 6BZ1 2.97 Å, MEF2 Chimera D83V mutant/DNA complex
Browse structure collections
About this viewer
MolViewer shows 6C9L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.