6CNF: Yeast RNA polymerase III elongation complex

Yeast RNA polymerase III elongation complex. Determined by electron microscopy at 4.5 Å resolution. Released 22 Aug 2018.

Method: Electron microscopy
Resolution: 4.5 Å
Organisms: Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Saccharomyces cerevisiae S288c
Chains: 21
Atoms: 47,675
Mol. weight: 891.16 kDa
Ligands: ZN
Released: 22 Aug 2018

Explore 6CNF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CNF contains 244 α-helices and 283 β-strands across 19 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 69 helices, 58 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	11-13	3	2
β-strand	17-19	3	3
α-helix	23-29	7
β-strand	33	1	4
α-helix	39-41	3
α-helix	73-76	4
β-strand	83	1	4
β-strand	84	1	5
α-helix	96-104	9
β-strand	106	1	6
β-strand	113	1	6
α-helix	117-127	11
α-helix	134-149	16
β-strand	153	1	7
β-strand	160	1	7
β-strand	178-180	3	8
α-helix	192-207	16
β-strand	220-222	3	8
α-helix	224-232	9
α-helix	239-241	3
α-helix	252-254	3
β-strand	261	1	5
α-helix	262-265	4
α-helix	266-268	3
α-helix	270-273	4
α-helix	279-281	3
α-helix	284-301	18
α-helix	309-327	19
α-helix	363-367	5
β-strand	372-373	2	9
β-strand	376-380	5	10
β-strand	381	1	11
α-helix	388	1
β-strand	391-395	5	10
α-helix	396-401	6
β-strand	404-407	4	12
α-helix	410-412	3
α-helix	413-422	10
β-strand	430-434	5	12
β-strand	442	1	12
β-strand	461-464	4	12
β-strand	470-476	7	10
β-strand	485-493	9	10
β-strand	498	1	11
β-strand	499	1	10
α-helix	502-504	3
α-helix	505-508	4
β-strand	516-520	5	10
α-helix	525-530	6
α-helix	531-535	5
α-helix	537-540	4
β-strand	543	1	13
β-strand	548	1	13
α-helix	555-565	11
β-strand	571	1	14
α-helix	573-583	11
α-helix	593-595	3
β-strand	604	1	14
α-helix	606-614	9
β-strand	626-628	3	15
α-helix	633-635	3
β-strand	652-655	4	15
β-strand	658-661	4	15
α-helix	677-685	9
α-helix	687-708	22
α-helix	714-717	4
α-helix	723-745	23
α-helix	761-784	24
α-helix	786	1
α-helix	790-796	7
α-helix	803-810	8
β-strand	818	1	16
β-strand	821	1	16
α-helix	823-825	3
β-strand	842	1	17
β-strand	845	1	17
α-helix	858-893	36
β-strand	897-898	2	18
β-strand	903-905	3	18
β-strand	911-915	5	18
α-helix	916-918	3
β-strand	928	1	19
β-strand	931	1	19
α-helix	935-946	12
β-strand	954	1	20
α-helix	956-974	19
β-strand	978	1	21
β-strand	982	1	21
α-helix	988-991	4
α-helix	999-1025	27
α-helix	1039	1
α-helix	1044-1047	4
α-helix	1052-1059	8
β-strand	1062	1	20
α-helix	1065-1080	16
α-helix	1083-1084	2
α-helix	1089-1098	10
α-helix	1123-1131	9
β-strand	1140-1143	4	22
α-helix	1153-1160	8
α-helix	1166-1169	4
β-strand	1172	1	23
β-strand	1175	1	24
β-strand	1176-1178	3	25
β-strand	1181-1183	3	25
β-strand	1184	1	26
β-strand	1187	1	23
α-helix	1191-1195	5
α-helix	1203-1212	10
β-strand	1232	1	26
α-helix	1255-1266	12
β-strand	1278-1286	9	22
β-strand	1290-1297	8	22
β-strand	1314-1315	2	22
α-helix	1319-1325	7
α-helix	1329-1345	17
α-helix	1352-1362	11
α-helix	1373-1376	4
α-helix	1383-1389	7
α-helix	1392-1402	11
α-helix	1411-1416	6
α-helix	1424-1427	4
β-strand	1430-1432	3	27
α-helix	1438-1441	4
α-helix	1448-1451	4
α-helix	1453-1455	3

Chain B: 46 helices, 84 β-strands

Element	Residues	Length	Sheet
α-helix	40-43	4
α-helix	44-46	3
α-helix	47-54	8
α-helix	60-67	8
α-helix	68-72	5
α-helix	73-79	7
β-strand	82-83	2	28
β-strand	93-100	8	28
α-helix	115-121	7
β-strand	127-134	8	28
β-strand	144-152	9	28
α-helix	169-173	5
β-strand	187	1	29
β-strand	190	1	29
β-strand	196-200	5	30
β-strand	205-207	3	31
β-strand	217-219	3	31
β-strand	221	1	32
β-strand	228	1	32
β-strand	231-236	6	31
β-strand	239-243	5	31
β-strand	247	1	33
β-strand	251-252	2	31
α-helix	253-259	7
α-helix	266-273	8
α-helix	279-291	13
α-helix	300-308	9
β-strand	309	1	33
α-helix	317-319	3
α-helix	326-330	5
α-helix	343-361	19
α-helix	372-374	3
β-strand	375-378	4	30
α-helix	380-408	29
α-helix	421-425	5
α-helix	428-439	12
β-strand	442-444	3	34
β-strand	449-451	3	34
α-helix	463-469	7
β-strand	472-475	4	30
α-helix	491-493	3
β-strand	510-513	4	30
β-strand	519-520	2	35
α-helix	521-523	3
α-helix	527-535	9
α-helix	541-543	3
β-strand	555-556	2	36
β-strand	561	1	36
α-helix	568-581	14
β-strand	591-593	3	36
β-strand	598-600	3	36
β-strand	608-609	2	35
β-strand	613-614	2	37
β-strand	615-616	2	38
β-strand	619-620	2	38
α-helix	628-631	4
α-helix	639-642	4
β-strand	646	1	37
α-helix	651-656	6
β-strand	659-660	2	37
β-strand	662	1	39
β-strand	665	1	39
β-strand	672-673	2	37
α-helix	677-680	4
α-helix	685-687	3
α-helix	691-693	3
α-helix	696-706	11
β-strand	709	1	40
α-helix	717-719	3
β-strand	724-725	2	41
β-strand	736-737	2	42
α-helix	739-744	6
α-helix	746-748	3
β-strand	753-759	7	43
β-strand	771	1	44
β-strand	772	1	43
β-strand	774	1	45
β-strand	785-794	10	41
β-strand	798	1	46
β-strand	802	1	46
β-strand	805	1	47
β-strand	812	1	48
β-strand	816	1	48
β-strand	829	1	49
β-strand	832	1	50
β-strand	834-836	3	41
β-strand	841-843	3	49
β-strand	846-848	3	47
β-strand	866-868	3	47
β-strand	871-872	2	49
β-strand	879-888	10	41
β-strand	894-904	11	41
β-strand	911-913	3	51
β-strand	919-921	3	51
β-strand	922	1	44
α-helix	925	1
β-strand	926	1	45
α-helix	938-940	3
β-strand	942-944	3	43
α-helix	948-952	5
α-helix	956-970	15
β-strand	974-975	2	42
β-strand	976-977	2	52
β-strand	980-981	2	52
α-helix	985-992	8
β-strand	1001-1002	2	53
β-strand	1005	1	54
β-strand	1012	1	54
β-strand	1017-1018	2	53
β-strand	1019-1024	6	43
β-strand	1025-1026	2	51
β-strand	1027	1	40
α-helix	1031-1034	4
β-strand	1036-1038	3	10
β-strand	1043	1	55
β-strand	1044	1	56
β-strand	1050	1	55
β-strand	1060-1061	2	9
α-helix	1064-1067	4
α-helix	1068-1073	6
α-helix	1076-1079	4
α-helix	1080-1085	6
β-strand	1091-1095	5	57
β-strand	1101	1	57
β-strand	1103	1	58
β-strand	1106	1	58
β-strand	1116-1120	5	57
α-helix	1123-1134	12
β-strand	1138-1140	3	3
β-strand	1143-1145	3	2

Chain C: 13 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	59
β-strand	12-13	2	59
α-helix	35-39	5
β-strand	42-47	6	60
β-strand	51-57	7	60
α-helix	62-72	11
β-strand	76-86	11	61
α-helix	94-102	9
β-strand	107	1	62
α-helix	115-117	3
α-helix	122-125	4
α-helix	128-130	3
β-strand	134-139	6	61
β-strand	141-142	2	63
β-strand	157-158	2	63
β-strand	161-162	2	64
β-strand	168-169	2	61
α-helix	175-178	4
β-strand	185	1	62
β-strand	194-195	2	64
β-strand	201-212	12	61
α-helix	217-219	3
β-strand	222-226	5	60
α-helix	228-230	3
β-strand	231	1	59
β-strand	234-235	2	65
α-helix	242-249	8
β-strand	256-258	3	66
β-strand	265-267	3	66
α-helix	279-282	4
β-strand	289-290	2	65
β-strand	292-294	3	59
β-strand	297-304	8	60
α-helix	310-330	21
α-helix	332-333	2
β-strand	334	1	67

Chain D: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-5	4	68
α-helix	16-26	11
α-helix	32-34	3
α-helix	56-71	16
α-helix	101-110	10
α-helix	118-122	5
α-helix	131-135	5
α-helix	147-160	14

Chain E: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2-24	23
β-strand	28	1	69
α-helix	32-35	4
α-helix	39-46	8
α-helix	56-58	3
β-strand	60-62	3	70
β-strand	64	1	69
α-helix	67-71	5
β-strand	78-82	5	70
α-helix	90-102	13
β-strand	107-112	6	70
α-helix	118-122	5
β-strand	131-136	6	70
α-helix	144-146	3
β-strand	153-155	3	71
α-helix	158-168	11
β-strand	177-178	2	71
α-helix	183-188	6
β-strand	195-202	8	71
β-strand	206-214	9	71

Chain F: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	73-75	3
α-helix	88-102	15
α-helix	117-127	11
β-strand	132-135	4	27
β-strand	145-147	3	27

Chain G: 2 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-12	9	68
α-helix	16-18	3
α-helix	22-33	12
β-strand	38	1	1
β-strand	45-48	4	68
β-strand	52	1	68
β-strand	57-58	2	27
β-strand	67-76	10	68
β-strand	83-85	3	72
β-strand	88-89	2	73
β-strand	97	1	74
β-strand	99-100	2	73
β-strand	101	1	75
β-strand	105	1	75
β-strand	110	1	74
β-strand	120-122	3	76
β-strand	126-129	4	76
β-strand	142	1	73
β-strand	148-150	3	72
β-strand	152-153	2	77
β-strand	196-197	2	77

Chain H: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	4-11	8	78
β-strand	12-15	4	79
β-strand	23-28	6	79
β-strand	38-43	6	79
β-strand	54-60	7	78
β-strand	95-98	4	78
β-strand	100-107	8	79
β-strand	111-117	7	79
β-strand	122-125	4	79
β-strand	141-145	5	78

11 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase III subunit RPC1	A	protein	1460	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P04051 (AlphaFold model)
DNA-directed RNA polymerase III subunit RPC2	B	protein	1149	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P22276 (AlphaFold model)
DNA-directed RNA polymerases I and III subunit RPAC1	C	protein	335	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P07703 (AlphaFold model)
DNA-directed RNA polymerase III subunit RPC9	D	protein	161	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P47076 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III subunit RPABC1	E	protein	215	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P20434
DNA-directed RNA polymerases I, II, and III subunit RPABC2	F	protein	155	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P20435
DNA-directed RNA polymerase III subunit RPC8	G	protein	212	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P35718
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	146	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P20436
DNA-directed RNA polymerase III subunit RPC10	I	protein	110	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	Q04307
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	70	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P22139
DNA-directed RNA polymerases I and III subunit RPAC2	K	protein	142	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P28000
DNA-directed RNA polymerases I, II, and III subunit RPABC4	L	protein	70	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P40422

9 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>6CNF_1 DNA-directed RNA polymerase III subunit RPC1 (chains A)
MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV
SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK
RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH
DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI
VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL
HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP
YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL
SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV
CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM
ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA
NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK
ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL
TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM
QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL
EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD
LVPKRCLFESLSNEAALKAN

Sequence of entity 2 (B), FASTA

>6CNF_2 DNA-directed RNA polymerase III subunit RPC2 (chains B)
MVAATKRRKTHIHKHVKDEAFDDLLKPVYKGKKLTDEINTAQDKWHLLPAFLKVKGLVKQ
HLDSFNYFVDTDLKKIIKANQLILSDVDPEFYLKYVDIRVGKKSSSSTKDYLTPPHECRL
RDMTYSAPIYVDIEYTRGRNIIMHKDVEIGRMPIMLRSNKCILYDADESKMAKLNECPLD
PGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKGIVQASVTSSTHERKSKTYVITKNGKI
YLKHNSIAEEIPIAIVLKACGILSDLEIMQLVCGNDSSYQDIFAVNLEESSKLDIYTQQQ
ALEYIGAKVKTMRRQKLTILQEGIEAIATTVIAHLTVEALDFREKALYIAMMTRRVVMAM
YNPKMIDDRDYVGNKRLELAGQLISLLFEDLFKKFNNDFKLSIDKVLKKPNRAMEYDALL
SINVHSNNITSGLNRAISTGNWSLKRFKMERAGVTHVLSRLSYISALGMMTRISSQFEKS
RKVSGPRALQPSQFGMLCTADTPEGEACGLVKNLALMTHITTDDEEEPIKKLCYVLGVED
ITLIDSASLHLNYGVYLNGTLIGSIRFPTKFVTQFRHLRRTGKVSEFISIYSNSHQMAVH
IATDGGRICRPLIIVSDGQSRVKDIHLRKLLDGELDFDDFLKLGLVEYLDVNEENDSYIA
LYEKDIVPSMTHLEIEPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKR
IDTLLYLMTYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDR
GFGRCETRRKTTTVLKRYANHTQDIIGGMRVDENGDPIWQHQSLGPDGLGEVGMKVQSGQ
IYINKSVPTNSADAPNPNNVNVQTQYREAPVIYRGPEPSHIDQVMMSVSDNDQALIKVLL
RQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMTVGKMIE
LISGKAGVLNGTLEYGTCFGGSKLEDMSKILVDQGFNYSGKDMLYSGITGECLQAYIFFG
PIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLL
ERLMISSDAFEVDVCDKCGLMGYSGWCTTCKSAENIIKMTIPYAAKLLFQELLSMNIAPR
LRLEDIFQQ

Sequence of entity 3 (C), FASTA

>6CNF_3 DNA-directed RNA polymerases I and III subunit RPAC1 (chains C)
MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINID
TSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNL
PDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNAHVYARDLKFEPQGRQSTTFA
DCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIK
GESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIF
NVESAGAMTPEEIFFKSVRILKNKAEYLKNCPITQ

Sequence of entity 4 (D), FASTA

>6CNF_4 DNA-directed RNA polymerase III subunit RPC9 (chains D)
MKVLEERNAFLSDYEVLKFLTDLEKKHLWDQKSLAALKKSRSKGKQNRPYNHPELQGITR
NVVNYLSINKNFINQEDEGEERESSGAKDAEKSGISKMSDESFAELMTKLNSFKLFKAEK
LQIVNQLPANMVHLYSIVEECDARFDEKTIEEMLEIISGYA

Sequence of entity 5 (E), FASTA

>6CNF_5 DNA-directed RNA polymerases I, II, and III subunit RPABC1 (chains E)
MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSF
QANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSA
MKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQR
ADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Sequence of entity 6 (F), FASTA

>6CNF_6 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQ
HEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRI
AMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Sequence of entity 7 (G), FASTA

>6CNF_7 DNA-directed RNA polymerase III subunit RPC8 (chains G)
MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLK
PGDGSSYINVTFRAVVFKPFLGEIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEGCY
YTPEESAWIWPMDEETKLYFDVNEKIRFRIEREVFVDVKPKSPKERELEERAQLENEIEG
KNEETPQNEKPPAYALLGSCQTDGMGLVSWWE

Sequence of entity 8 (H), FASTA

>6CNF_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA
SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGG
LLMRLEGNYRNLNNLKQENAYLLIRR

Sequence of entity 9 (I), FASTA

>6CNF_9 DNA-directed RNA polymerase III subunit RPC10 (chains I)
MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWD
NVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKEN

Sequence of entity 10 (J), FASTA

>6CNF_10 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKF
LRYNPLEKRD

Sequence of entity 11 (K), FASTA

>6CNF_11 DNA-directed RNA polymerases I and III subunit RPAC2 (chains K)
MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTS
ASFQIVEEDHTLGNALRYVIMKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKG
LKDLMDLCDVVESKFTEKIKSM

Sequence of entity 12 (L), FASTA

>6CNF_12 DNA-directed RNA polymerases I, II, and III subunit RPABC4 (chains L)
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKAR
TKRLVQFEAR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	7

Primary citation

Structural visualization of RNA polymerase III transcription machineries. Han, Y., Yan, C., Fishbain, S. et al. Cell Discov (2018) 4:40-40. DOI 10.1038/s41421-018-0044-z · PubMed

Other PDB entries of the same protein (UniProt P04051 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z0H 2.6 Å, Structure of yeast RNA Polymerase III-Ty1 integrase complex at 2.6 A (focus subunit AC40).
7Z1O 2.7 Å, Structure of yeast RNA Polymerase III PTC + NTPs
7Z31 2.76 Å, Structure of yeast RNA Polymerase III-Ty1 integrase complex at 2.7 A (focus subunit C11,…
7Z1L 2.8 Å, Structure of yeast RNA Polymerase III Pre-Termination Complex (PTC)
7Z30 2.9 Å, Structure of yeast RNA Polymerase III-Ty1 integrase complex at 2.9 A (focus subunit C11…
7Z2Z 3.07 Å, Structure of yeast RNA Polymerase III-DNA-Ty1 integrase complex (Pol III-DNA-IN1) at 3.1 A
8BWS 3.2 Å, Structure of yeast RNA Polymerase III elongation complex at 3.3 A
6TUT 3.25 Å, Cryo-EM structure of the RNA Polymerase III-Maf1 complex
6EU3 3.3 Å, Apo RNA Polymerase III - closed conformation (cPOL3)
6EU1 3.4 Å, RNA Polymerase III - open DNA complex (OC-POL3).
6EU2 3.4 Å, Apo RNA Polymerase III - open conformation (oPOL3)
7Z1M 3.4 Å, Structure of yeast RNA Polymerase III Elongation Complex (EC)

Browse structure collections

About this viewer

MolViewer shows 6CNF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.