Crystal structure of the prostaglandin D2 receptor CRTH2 with CAY10471. Determined by X-ray diffraction at 2.74 Å resolution. Released 3 Oct 2018.
Explore 6D27 in 3D Show helices and sheets RCSB PDB PDBe
6D27 contains 25 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-17 | 6 | |
| α-helix | 33-59 | 27 | |
| α-helix | 66-92 | 27 | |
| α-helix | 102-134 | 33 | |
| α-helix | 136-142 | 7 | |
| α-helix | 145-162 | 18 | |
| α-helix | 164-168 | 5 | |
| β-strand | 170-174 | 5 | 1 |
| β-strand | 180-184 | 5 | 1 |
| α-helix | 195-211 | 17 | |
| α-helix | 212-216 | 5 | |
| α-helix | 217-1241 | 24 | |
| α-helix | 1272-1281 | 10 | |
| α-helix | 1286-1291 | 6 | |
| α-helix | 1294-1312 | 19 | |
| α-helix | 1316-1323 | 8 | |
| α-helix | 1327-1335 | 9 | |
| α-helix | 1338-1342 | 5 | |
| α-helix | 1344-1356 | 13 | |
| α-helix | 1362-2239 | 3 | |
| α-helix | 2241-2242 | 2 | |
| α-helix | 2245-2258 | 14 | |
| α-helix | 2260-2271 | 12 | |
| α-helix | 2276-2278 | 3 | |
| α-helix | 2279-2294 | 16 | |
| α-helix | 2296-2306 | 11 | |
| α-helix | 2309-2326 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Prostaglandin D2 receptor 2, Endolysin chimera | A | protein | 470 | Homo sapiens, Enterobacteria phage T4 | P00720, Q9Y5Y4 (AlphaFold model) |
>6D27_1 Prostaglandin D2 receptor 2, Endolysin chimera (chains A) GMSANATLKPLCPILEQMSRLQSHSATSIRYIDHAAVLLHGLASLLGLVENGVILFVVGC RMRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASG FLLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGR IMCYYNVLLLNPGPDRDATCNSRQAALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRADL GLQHRNIFEMLRIDEGGGSGGDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAAL INMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWD AYRRRPGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFF NSVANPVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSLEVLFQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| FT4 | [(3R)-3-{[(4-fluorophenyl)sulfonyl](methyl)amino}-1,2,3,4-tetrahydro-9H-carbazo… | C21 H21 F N2 O4 S | 1 |
| OLA | Oleic acid | C18 H34 O2 | 2 |
| PGO | S-1,2-propanediol | C3 H8 O2 | 4 |
Water and common crystallization additives (SO4, MES, PGE, PEG) are not listed.
Structures of the Human PGD2Receptor CRTH2 Reveal Novel Mechanisms for Ligand Recognition. Wang, L., Yao, D., Deepak, R.N.V.K. et al. Mol Cell (2018) 72:48-59.e4. DOI 10.1016/j.molcel.2018.08.009 · PubMed
Other PDB entries of the same protein (UniProt P00720), best resolution first:
MolViewer shows 6D27 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.