6DGK: Non-structural protein 1

Crystal Structure of the Non-Structural Protein 1 (NS1) effector domain W187A mutant from the A/Brevig Mission/1/1918 (H1N1) strain of Influenza A Virus. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Aug 2018.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Influenza A virus (strain A/Brevig Mission/1/1918 H1N1)
Chains: 2
Atoms: 2,094
Mol. weight: 26.97 kDa
Released: 15 Aug 2018

Explore 6DGK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6DGK contains 6 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	88-91	4	1
α-helix	95-99	5
β-strand	107-112	6	1
β-strand	115-120	6	1
β-strand	127-137	11	1
β-strand	140-151	12	1
β-strand	156-162	7	1
α-helix	171-187	17
β-strand	191-194	4	1
α-helix	196-203	8

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	88-91	4	2
α-helix	95-99	5
β-strand	107-112	6	2
β-strand	115-120	6	2
β-strand	127-137	11	2
β-strand	140-151	12	2
β-strand	156-162	7	2
α-helix	171-186	16
β-strand	191-194	4	2
α-helix	196-203	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 1	A, B	protein	120	Influenza A virus (strain A/Brevig Mission/1/1918 H1N1)	Q99AU3

Sequence of entity 1 (A, B), FASTA

>6DGK_1 Non-structural protein 1 (chains A, B)
ASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLI
LLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGVLIGGLEANDNTVRVSETLQRFAWRS

Primary citation

Structural analyses reveal the mechanism of inhibition of influenza virus NS1 by two antiviral compounds. Kleinpeter, A.B., Jureka, A.S., Falahat, S.M. et al. J Biol Chem (2018) 293:14659-14668. DOI 10.1074/jbc.RA118.004012 · PubMed

Other PDB entries of the same protein (UniProt Q99AU3), best resolution first:

5UL6 1.45 Å, The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host…
6ATV 1.75 Å, The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host…
6OX7 2.75 Å, The complex of 1918 NS1-ED and the iSH2 domain of the human p85beta subunit of PI3K
6U28 2.95 Å, Crystal structure of 1918 NS1-ED W187A in complex with the p85-beta-iSH2 domain of human…
2N74 Solution Structure of the RNA-Binding domain of non-structural protein 1 from the 1918…
6NU0 Solution NMR structure of 1918 NS1 effector domain

Browse structure collections

About this viewer

MolViewer shows 6DGK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.