The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host protein-protein interactions. Determined by X-ray diffraction at 1.75 Å resolution. Released 8 Aug 2018.
Explore 6ATV in 3D Show helices and sheets RCSB PDB PDBe
6ATV contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 136-139 | 4 | 1 |
| β-strand | 143 | 1 | 2 |
| β-strand | 150 | 1 | 1 |
| β-strand | 153 | 1 | 2 |
| β-strand | 158-163 | 6 | 1 |
| β-strand | 169-173 | 5 | 1 |
| β-strand | 179-183 | 5 | 1 |
| α-helix | 184-186 | 3 | |
| β-strand | 187-190 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-8 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Adapter molecule crk | A | protein | 58 | Homo sapiens | P46108 (AlphaFold model) |
| proline-rich motif in IAV-NS1 | M | protein | 15 | Orthomyxoviridae | Q99AU3 |
>6ATV_1 Adapter molecule crk (chains A) AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR
>6ATV_2 proline-rich motif in IAV-NS1 (chains M) XYGRPPLPPKQKRKX
Molecular Mechanisms of Tight Binding through Fuzzy Interactions. Shen, Q., Shi, J., Zeng, D. et al. Biophys J (2018) 114:1313-1320. DOI 10.1016/j.bpj.2018.01.031 · PubMed
Other PDB entries of the same protein (UniProt P46108 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6ATV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.