The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host protein-protein interactions. Determined by X-ray diffraction at 1.45 Å resolution. Released 9 Aug 2017.
Explore 5UL6 in 3D Show helices and sheets RCSB PDB PDBe
5UL6 contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 135-139 | 5 | 1 |
| β-strand | 143 | 1 | 2 |
| β-strand | 150 | 1 | 1 |
| β-strand | 153 | 1 | 2 |
| β-strand | 158-163 | 6 | 1 |
| β-strand | 169-173 | 5 | 1 |
| β-strand | 179-183 | 5 | 1 |
| α-helix | 184-186 | 3 | |
| β-strand | 187-190 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-8 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Adapter molecule crk | A | protein | 58 | Homo sapiens | P46108 (AlphaFold model) |
| Proline-rich motif of nonstructural protein 1 of influenza a virus | M | protein | 15 | Influenza A virus | Q99AU3 |
>5UL6_1 Adapter molecule crk (chains A) AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR
>5UL6_2 Proline-rich motif of nonstructural protein 1 of influenza a virus (chains M) XYGRPPLPPKQKRKX
The Molecular Mechanisms Underlying the Hijack of Host Proteins by the 1918 Spanish Influenza Virus. Shen, Q., Zeng, D., Zhao, B. et al. ACS Chem Biol (2017) 12:1199-1203. DOI 10.1021/acschembio.7b00168 · PubMed
Other PDB entries of the same protein (UniProt P46108 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5UL6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.