6NU0: 1918 NS1 effector domain

Solution NMR structure of 1918 NS1 effector domain. Determined by solution NMR. Released 8 Jan 2020.

Method: Solution NMR
Organism: Influenza A virus
Chains: 1
Atoms: 943
Mol. weight: 26.07 kDa
Released: 8 Jan 2020

Explore 6NU0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NU0 contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	88-91	4	1
α-helix	95-99	5
β-strand	107-112	6	1
β-strand	115-120	6	1
β-strand	127-137	11	1
β-strand	140-151	12	1
β-strand	156-162	7	1
α-helix	171-187	17
β-strand	191-194	4	1
α-helix	196-199	4
α-helix	200-204	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 1	A	protein	230	Influenza A virus	Q99AU3

Sequence of entity 1 (A), FASTA

>6NU0_1 Non-structural protein 1 (chains A)
MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRA
GKQIVERILKEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMD
QAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV
LIGGLERNDNTVRVSETLQRFAWRSSNENGRPPLPPKQKRKMARTIKSEV

Primary citation

The structure and conformational plasticity of the nonstructural protein 1 of the 1918 influenza A virus. Shen, Q., Cho, J.H. Biochem Biophys Res Commun (2019) 518:178-182. DOI 10.1016/j.bbrc.2019.08.027 · PubMed

Other PDB entries of the same protein (UniProt Q99AU3), best resolution first:

5UL6 1.45 Å, The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host…
6ATV 1.75 Å, The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host…
6DGK 1.9 Å, Crystal Structure of the Non-Structural Protein 1 (NS1) effector domain W187A mutant…
6OX7 2.75 Å, The complex of 1918 NS1-ED and the iSH2 domain of the human p85beta subunit of PI3K
6U28 2.95 Å, Crystal structure of 1918 NS1-ED W187A in complex with the p85-beta-iSH2 domain of human…
2N74 Solution Structure of the RNA-Binding domain of non-structural protein 1 from the 1918…

Browse structure collections

About this viewer

MolViewer shows 6NU0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.