Crystal structure of eukaryotic DNA primase large subunit iron-sulfur cluster domain Y395L mutant. Determined by X-ray diffraction at 1.82 Å resolution. Released 12 Dec 2018.
Explore 6DU0 in 3D Show helices and sheets RCSB PDB PDBe
6DU0 contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 323-325 | 3 | |
| α-helix | 327-330 | 4 | |
| α-helix | 335-347 | 13 | |
| α-helix | 352-364 | 13 | |
| α-helix | 369-381 | 13 | |
| α-helix | 382-384 | 3 | |
| α-helix | 388-394 | 7 | |
| α-helix | 396-403 | 8 | |
| α-helix | 413-416 | 4 | |
| α-helix | 417-422 | 6 | |
| α-helix | 424-426 | 3 | |
| α-helix | 435-438 | 4 | |
| α-helix | 441-449 | 9 | |
| α-helix | 455-466 | 12 | |
| α-helix | 470-480 | 11 | |
| α-helix | 500-511 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA primase large subunit | A | protein | 201 | Saccharomyces cerevisiae | P20457 (AlphaFold model) |
>6DU0_1 DNA primase large subunit (chains A) GPGSDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLSLFLKGIGLSADE ALKFWSEAFTRNGNMTMEKFNKELRYSFRHNYGLEGNRINYKPWDCHTILSKPRPGRGDY HGCPFRDWSHERLSAELRSMKLTQAQIISVLDSCQKGEYTIACTKVFEMTHNSASADLEI GEQTHIAHPNLYFERSRQLQK
| ID | Name | Formula | Copies |
|---|---|---|---|
| SF4 | Iron/sulfur cluster | Fe4 S4 | 1 |
Water and common crystallization additives (GOL, MPD) are not listed.
Yeast require redox switching in DNA primase. O'Brien, E., Salay, L.E., Epum, E.A. et al. Proc Natl Acad Sci U S A (2018) 115:13186-13191. DOI 10.1073/pnas.1810715115 · PubMed
Other PDB entries of the same protein (UniProt P20457 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6DU0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.